IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ cao-2009-4 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Cao Z., Wara AK., Icli B., Sun X., Packard RR., Esen F., Stapleton CJ., Subramaniam M., Kretschmer K., Apostolou I., von Boehmer H., Hansson GK., Spelsberg TC., Libby P., Feinberg MW. IBD - Inflammatory bowel disease mfeinberg@rics.bwh.harvard.edu The Journal of biological chemistry 2009 Only protein-protein interactions imex curation imex curation klf10_human Krueppel-like factor 10 Transforming growth factor-beta-inducible early growth response protein 1 EGR-alpha KLF10 TIEG TIEG1 protein protein human Homo sapiens Human MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKSLSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVDEKASAALYDFSVPSSETVICRSQPAPVSPQQKSVLVSPPAVSAGGVPPMPVICQMVPLPANNPVVTTVVPSTPPSQPPAVCPPVVFMGTQVPKGAVMFVVPQPVVQSSKPPVVSPNGTRLSPIAPAPGFSPSAAKVTPQIDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTHTGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALPPTPAPTQ tgfb1_human_gene TGFB1_HUMAN_GENE gene gene human Homo sapiens Human 124-1 1853588 N/A 1853589 unspecified role unspecified role bait bait N/A 1853590 unspecified role unspecified role prey prey association association false false false 2C KLF10 binding was reduced in the presence of the 453-bp TGF-β1 MUT promoter bearing a 2-bp mutation of the KLF binding site.