IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hu-2009b-1 Estrogen receptor alpha, fos-related antigen-2, and c-Jun coordinately regulate human UDP glucuronosyltransferase 2B15 and 2B17 expression in response to 17beta-estradiol in MCF-7 cells. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Hu D.G., Mackenzie P.I. IBD - Inflammatory bowel disease peter.mackenzie@flinders.edu.au Mol. Pharmacol. (0026-895X) 2009 Only protein-protein interactions imex curation hu-2009b-3 Estrogen receptor alpha, fos-related antigen-2, and c-Jun coordinately regulate human UDP glucuronosyltransferase 2B15 and 2B17 expression in response to 17beta-estradiol in MCF-7 cells. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa autoradiography autoradiography Hu D.G., Mackenzie P.I. IBD - Inflammatory bowel disease peter.mackenzie@flinders.edu.au Mol. Pharmacol. (0026-895X) 2009 Only protein-protein interactions imex curation hu-2009b-2 Estrogen receptor alpha, fos-related antigen-2, and c-Jun coordinately regulate human UDP glucuronosyltransferase 2B15 and 2B17 expression in response to 17beta-estradiol in MCF-7 cells. in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Hu D.G., Mackenzie P.I. IBD - Inflammatory bowel disease peter.mackenzie@flinders.edu.au Mol. Pharmacol. (0026-895X) 2009 Only protein-protein interactions imex curation tff1_human_gene PS2/TFFI HUMAN GENE gene gene human Homo sapiens Human fosl2_human Fos-related antigen 2 FOSL2 FRA2 protein protein human Homo sapiens Human MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF esr1_human Estrogen receptor ESR1 ESR NR3A1 Estradiol receptor ER-alpha Nuclear receptor subfamily 3 group A member 1 protein protein human Homo sapiens Human MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV udb15_human_gene UDP-glucuronosyltransferase 2B15 (UGT2B15) human gene gene gene human Homo sapiens Human vita2_xenla_ere-site_dna-probe Xenopus laevis VITA2 gene promoter estrogen response element site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid xenla Xenopus laevis (African clawed frog) African clawed frog AAAGTCAGGTCACAGTGACCTGATCAAAG udb15_human_3prime-ere-half-site_dna-probe Human UDB15 gene promoter 3-prime estrogen response element half-site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human AAATAAATATGAGGTCATCAATCTTTTGTTG udb15_human_5prime-ere-half-site_dna-probe Human UDB15 gene promoter 5-prime estrogen response element half-site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human CTTACATATTCTAGGTCATAAAAATTATTG udb15_human_5prime-ap1-site_dna-probe Human UDB15 gene promoter activator protein 1 distal site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human GTACACACTAATTGGTGAGTCATATGGTATATG fosl2-tff1-1 1776113 n/a 1776116 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1776117 unspecified role unspecified role bait bait association association false false false Fig. 7a, 7b 17beta-estradiol (E2) (CHEBI:16469) CHEBI:16469 increases binding of P15408 to ENSG00000160182 jun-tff1-1 1776113 n/a 1776116 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1776118 unspecified role unspecified role bait bait association association false false false Fig. 7a, 7b 17beta-estradiol (E2) (CHEBI:16469) CHEBI:16469 increases binding of P05412 to ENSG00000160182 esr1-tff1-2 1776113 n/a 1776116 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1776119 unspecified role unspecified role bait bait association association false false false Fig. 7a, 7b 17beta-estradiol (E2) (CHEBI:16469) CHEBI:16469 increases binding of P03372 to ENSG00000160182 esr1-udb15-1 1776113 n/a 1776120 unspecified role unspecified role prey prey promoter region estrogen response elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false promoter region activator protein-1 elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1776119 unspecified role unspecified role bait bait association association false false false Fig. 7c, 7d 17beta-estradiol (E2) (CHEBI:16469) CHEBI:16469 increases binding of P03372 to ENSG00000196620 CHEBI:16469 indirectly increases expression at RNA level of ENSG00000196620 P03372 increases expression at RNA level of ENSG00000196620 jun-udb15-1 1776113 n/a 1776120 unspecified role unspecified role prey prey promoter region estrogen response elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false promoter region activator protein-1 elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1776118 unspecified role unspecified role bait bait association association false false false Fig. 7c, 7d 17beta-estradiol (E2) (CHEBI:16469) CHEBI:16469 increases binding of P05412 to ENSG00000196620 P05412 increases expression at RNA level of ENSG00000196620 fosl2-udb15-1 1776113 n/a 1776120 unspecified role unspecified role prey prey promoter region estrogen response elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false promoter region activator protein-1 elements binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1776117 unspecified role unspecified role bait bait association association false false false Fig. 7c, 7d 17beta-estradiol (E2) (CHEBI:16469) CHEBI:16469 increases binding of P15408 to ENSG00000196620 P15408 increases expression at RNA level of ENSG00000196620 vita2-esr1-1 1776114 n/a 1776121 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1776119 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false Fig. 5a, 5b vita2-esr1-2 1776114 n/a 1776121 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1776121 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1776119 unspecified role unspecified role prey prey in vitro In vitro association association false false false Fig. 5b vita2-esr1-3 1776114 n/a 1776119 unspecified role unspecified role prey prey in vitro In vitro n/a 1776122 competitor competitor competitor prey prey g13a_g14a_t15a_c16a mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1776121 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 5b vita2-esr1-4 1776114 n/a 1776123 competitor competitor competitor prey prey g14t_g15t_c17t_a18t mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1776119 unspecified role unspecified role prey prey in vitro In vitro n/a 1776121 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 5b udb15-jun-1 1776115 n/a 1776124 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1776118 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells physical association physical association false false false Fig. 4a Nuclear extracts were prepared from MCF-7 cells stimulated with 17beta-estradiol (CHEBI:16469). udb15-fosl2-1 1776115 n/a 1776124 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1776117 unspecified role unspecified role prey prey human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells physical association physical association false false false Fig. 4a Nuclear extracts were prepared from MCF-7 cells stimulated with 17beta-estradiol (CHEBI:16469). vita2-esr1-5 1776115 n/a 1776121 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1776119 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false Fig. 5a, 5b