IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ shin-2009-3 in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Shin DJ., Osborne TF. Diabetes - Interactions investigated in the context of Diabetes HA-FOXO1 has been entered as being of Murine origin based on Ref 48 -Accili et al., (PMID:11696581) which specifically mentions a Murine HA-FOXO1 construct. Previous work by donator of FLAG-FOXO1 plasmids -T Unterman (Refs 53,56, 42 -referring to Rena et al., 1999 pmid:10358075) refers to Human FOXO1. tim.osborne@uci.edu The Journal of biological chemistry 2009 Only protein-protein interactions imex curation imex curation IBD - Inflammatory bowel disease shin-2009-2 mouse-hepatocyte Mouse hepatocyte hepatocyte Liver primary cell A hepatocyte is a cell of the main tissue of the liver. ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Shin DJ., Osborne TF. Diabetes - Interactions investigated in the context of Diabetes HA-FOXO1 has been entered as being of Murine origin based on Ref 48 -Accili et al., (PMID:11696581) which specifically mentions a Murine HA-FOXO1 construct. Previous work by donator of FLAG-FOXO1 plasmids -T Unterman (Refs 53,56, 42 -referring to Rena et al., 1999 pmid:10358075) refers to Human FOXO1. tim.osborne@uci.edu The Journal of biological chemistry 2009 Only protein-protein interactions imex curation imex curation IBD - Inflammatory bowel disease foxo1_human Forkhead box protein O1 FOXO1 FKHR FOXO1A Forkhead box protein O1A Forkhead in rhabdomyosarcoma protein protein human Homo sapiens Human MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG rat_cyp7a1_promoter_probe_1/1 dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid rat Rattus norvegicus (Rat) Rat AGGACAAATAGTGTTTGCTTTGGTCACTCA igfbp1_response_element dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) CACTAGCAAAACAAACTTATTTTGAACAC rat_cyp7a1_promoter_probe_1/2 dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid rat Rattus norvegicus (Rat) Rat TGTGCTCATCTGTTTACTTCTTTTTC foxo1_mouse Forkhead box protein O1 Foxo1 Fkhr Foxo1a Forkhead box protein O1A Forkhead in rhabdomyosarcoma protein protein mouse Mus musculus Mouse MAEAPQVVETDPDFEPLPRQRSCTWPLPRPEFNQSNSTTSSPAPSGGAAANPDAAASLASASAVSTDFMSNLSLLEESEDFARAPGCVAVAAAAAASRGLCGDFQGPEAGCVHPAPPQPPPTGPLSQPPPVPPSAAAAAGPLAGQPRKTSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEGPGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGDGDVHSLVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGSMMQQTPCYSFAPPNTSLNSPSPNYSKYTYGQSSMSPLPQMPMQTLQDSKSSYGGLNQYNCAPGLLKELLTSDSPPHNDIMSPVDPGVAQPNSRVLGQNVMMGPNSVMPAYGSQASHNKMMNPSSHTHPGHAQQTASVNGRTLPHVVNTMPHTSAMNRLTPVKTPLQVPLSHPMQMSALGSYSSVSSCNGYGRMGVLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG cp7a1_mouse_gene Cholesterol 7-alpha-monooxygenase Cyp7a1 Cyp7 gene gene mouse Mus musculus Mouse rat_cyp7a1_promoter_probe_1/1-foxo1-1 1855766 N/A 1855768 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 1855769 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false T_T14-15G_G mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Supp 2A igfbp1_response_element-foxo1-1 1855766 N/A 1855768 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 1855770 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Supp 2A/B The species of origin for the "insulin-like growth factor binding protein-1/insulin response element" could be either murine or human, according to Blat results. The stated reference for this construct (Guo et al., 1999) cannot be accessed. rat_cyp7a1_promoter_probe_1/1-foxo1-2 1855766 N/A 1855768 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 1855771 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false T_T14-15G_G mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Supp 2B foxo1-cyp7a1-1 1855767 N/A 1855772 unspecified role unspecified role bait bait n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1855773 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 2A, 6C O35622 decreases the expression at RNA level of ENSMUSG00000028240 O35622 increases phosphorylation of Q9R1E0 O95750 decreases binding of Q9R1E0 to ENSMUSG00000028240 O95750 decreases the expression at RNA level of ENSMUSG00000028240 O95750 increases phosphorylation of Q9R1E0 CHEBI:52289 indirectly inhibits phosphorylation of Q9R1E0 CHEBI:52289 increased expression at RNA level of ENSMUSG00000028240 (in presence of O95750) CHEBI:52289 inhibits the activity of O95750 CHEBI:9288 increased expression at RNA level of ENSMUSG00000028240 P01308 decreased expression at RNA level of ENSMUSG00000028240