IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fragale-2008-1 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Fragale A., Gabriele L., Stellacci E., Borghi P., Perrotti E., Ilari R., Lanciotti A., Remoli AL., Venditti M., Belardelli F., Battistini A. IBD - Inflammatory bowel disease battist@iss.it Journal of immunology (Baltimore, Md. : 1950) 2008 imex curation Fragale A., Gabriele L., Stellacci E., Borghi P., Perrotti E., Ilari R., Lanciotti A., Remoli AL., Venditti M., Belardelli F., Battistini A., Fragale A., Gabriele L., Stellacci E., Borghi P., Perrotti E., Ilari R., Lanciotti A., Remoli AL., Venditti M., Belardelli F., Battistini A. Only protein-protein interactions imex curation fragale-2008-2 human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Fragale A., Gabriele L., Stellacci E., Borghi P., Perrotti E., Ilari R., Lanciotti A., Remoli AL., Venditti M., Belardelli F., Battistini A. IBD - Inflammatory bowel disease CD4+CD25− T cells, CD4+CD25+ Treg cells and CD4+ cells. battist@iss.it Journal of immunology (Baltimore, Md. : 1950) 2008 imex curation Fragale A., Gabriele L., Stellacci E., Borghi P., Perrotti E., Ilari R., Lanciotti A., Remoli AL., Venditti M., Belardelli F., Battistini A., Fragale A., Gabriele L., Stellacci E., Borghi P., Perrotti E., Ilari R., Lanciotti A., Remoli AL., Venditti M., Belardelli F., Battistini A. Only protein-protein interactions imex curation fragale-2008-3 mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Fragale A., Gabriele L., Stellacci E., Borghi P., Perrotti E., Ilari R., Lanciotti A., Remoli AL., Venditti M., Belardelli F., Battistini A., Fragale A., Gabriele L., Stellacci E., Borghi P., Perrotti E., Ilari R., Lanciotti A., Remoli AL., Venditti M., Belardelli F., Battistini A. IBD - Inflammatory bowel disease CD4+CD25− T cells, CD4+CD25+ Treg cells and CD4+ cells. battist@iss.it Journal of immunology (Baltimore, Md. : 1950) 2008 Only protein-protein interactions imex curation imex curation irf1_human Interferon regulatory factor 1 IRF1 protein protein human Homo sapiens Human MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP conserved-region_foxp3_promoter_irf-e/isre Human_FOXP3_ IFN-stimulated response element dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) CCAAAATTTCAAAATTTCCGTTTAAGTCTCA c13_canonical irf-1 consensus sequence dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human GATCAACTGAAACTGAAACTGAAACTGA irf1_mouse Interferon regulatory factor 1 Irf1 protein protein mouse Mus musculus Mouse MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTRNQRKERKSKSSRDTKSKTKRKLCGDVSPDTFSDGLSSSTLPDDHSSYTTQGYLGQDLDMERDITPALSPCVVSSSLSEWHMQMDIIPDSTTDLYNLQVSPMPSTSEAATDEDEEGKIAEDLMKLFEQSEWQPTHIDGKGYLLNEPGTQLSSVYGDFSCKEEPEIDSPRGDIGIGIQHVFTEMKNMDSIMWMDSLLGNSVRLPPSIQAIPCAP foxp3_human_gene Forkhead box protein P3 (FOXP3) human gene gene gene human Homo sapiens Human foxp3_mouse_gene Forkhead box protein P3 Foxp3 gene gene mouse Mus musculus Mouse conserved_region_foxp3_promoter_irf_e/isre-irf1-1 1853594 N/A 1853597 unspecified role unspecified role prey prey human-jurkat Homo sapiens jurkat Human T cell leukemia N/A 1853598 unspecified role unspecified role bait bait T16G,G20A,T22C mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 5B Interferon - gamma (P01579) increases binding. P10914 decreases expression at RNA level of ENSMUSG00000039521 P01579 decreases expression at RNA level of ENSMUSG00000039521 c13_canonical irf_1 consensus sequence-irf1-1 1853594 N/A 1853597 unspecified role unspecified role prey prey human-jurkat Homo sapiens jurkat Human T cell leukemia N/A 1853599 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 5B-2 Interferon - gamma (P01579) increases binding. conserved_region_foxp3_promoter_irf_e/isre-irf1-2 1853594 N/A 1853600 unspecified role unspecified role prey prey mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes N/A 1853598 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 6A Less IRF1 was bound when using CD4+CD25+ T- Reg cells as compared with CD4+CD25− T cells. TGFB1 (P01137) conserved_region_foxp3_promoter_irf_e/isre-irf1-3 1853594 N/A 1853597 unspecified role unspecified role prey prey human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes N/A 1853598 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 6A-2 Less IRF1 was bound when using CD4+CD25+ T- Reg cells as compared with CD4+CD25− T cells. TGFB1 (P01137) irf1-foxp3-1 1853595 N/A 1853601 unspecified role unspecified role prey prey promoter_irf-e/isre_site IRF-E_binding_site sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1853597 unspecified role unspecified role bait bait association association false false false 6C P60568 increases expression at protein level of ENSMUSG00000039521 Less IRF1 was bound when using CD4+CD25+ T- Reg cells as compared with CD4+CD25− T cells. P10914 decreases expression at RNA level of ENSG00000049768 irf1-foxp3-2 1853596 N/A 1853602 unspecified role unspecified role unspecified role unspecified role promoter_irf-e/isre_site IRF-E_binding_site sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1853600 unspecified role unspecified role unspecified role unspecified role association association false false false 6D Less IRF1 was bound when using CD4+CD25+ T- Reg cells as compared with CD4+CD25− T cells. P15314 decreases expression at RNA level of ENSMUSG00000039521