DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhou-2008-1 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhou L., Lopes JE., Chong MM., Ivanov II., Min R., Victora GD., Shen Y., Du J., Rubtsov YP., Rudensky AY., Ziegler SF., Littman DR. IBD - Inflammatory bowel disease littman@saturn.med.nyu.edu Nature 2008 imex curation Only protein-protein interactions zhou-2008-2 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Zhou L., Lopes JE., Chong MM., Ivanov II., Min R., Victora GD., Shen Y., Du J., Rubtsov YP., Rudensky AY., Ziegler SF., Littman DR. IBD - Inflammatory bowel disease littman@saturn.med.nyu.edu Nature 2008 imex curation Only protein-protein interactions zhou-2008-3 mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Zhou L., Lopes JE., Chong MM., Ivanov II., Min R., Victora GD., Shen Y., Du J., Rubtsov YP., Rudensky AY., Ziegler SF., Littman DR. IBD - Inflammatory bowel disease Naive CD4+ T cells, from spleen, were stimulated with either anti-T-cell receptor (TCR) or anti-CD3/CD28 and TGF-beta. littman@saturn.med.nyu.edu Nature 2008 imex curation Only protein-protein interactions zhou-2008-4 mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Zhou L., Lopes JE., Chong MM., Ivanov II., Min R., Victora GD., Shen Y., Du J., Rubtsov YP., Rudensky AY., Ziegler SF., Littman DR. IBD - Inflammatory bowel disease T cells CD4+GFPint and CD4+GFP were isolated from the intestinal lamina propria of RORc(γt)+/gfp mice. littman@saturn.med.nyu.edu Nature 2008 imex curation Only protein-protein interactions foxp3_human Forkhead box protein P3 Scurfin FOXP3 IPEX JM2 protein protein human Homo sapiens Human MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQLQLPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQRPSRCSNPTPGP rorg_human Nuclear receptor ROR-gamma RORC NR1F3 RORG RZRG Nuclear receptor RZR-gamma Nuclear receptor subfamily 1 group F member 3 Retinoid-related orphan receptor-gamma RAR-related orphan receptor C protein protein human Homo sapiens Human MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK p51450-2 Nuclear receptor ROR-gamma RORgT Rorc Nr1f3 Rorg Thor Nuclear receptor RZR-gamma Nuclear receptor subfamily 1 group F member 3 Retinoid-related orphan receptor-gamma Thymus orphan receptor RAR-related orphan receptor C protein protein mouse Mus musculus Mouse MRTQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQCNVAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLGLSDGQLPLGASPDLPEASACPPGLLRASGSGPPYSNTLAKTEVQGASCHLEYSPERGKAEGRDSIYSTDGQLTLGRCGLRFEETRHPELGEPEQGPDSHCIPSFCSAPEVPYASLTDIEYLVQNVCKSFRETCQLRLEDLLRQRTNLFSREEVTSYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIILLTAGAMEVVLVRMCRAYNANNHTVFFEGKYGGVELFRALGCSELISSIFDFSHFLSALCFSEDEIALYTALVLINANRPGLQEKRRVEHLQYNLELAFHHHLCKTHRQGLLAKLPPKGKLRSLCSQHVEKLQIFQHLHPIVVQAAFPPLYKELFSTDVESPEGLSK Produced by alternative promoter usage. foxp3_mouse Forkhead box protein P3 Foxp3 Scurfin protein protein mouse Mus musculus Mouse MPNPRPAKPMAPSLALGPSPGVLPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPPSQLQLPTVPLVMVAPSGARLGPSPHLQALLQDRPHFMHQLSTVDAHAQTPVLQVRPLDNPAMISLPPPSAATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPRSGTPRKDSNLLAAPQGSYPLLANGVCKWPGCEKVFEEPEEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKEKLGAMQAHLAGKMALAKAPSVASMDKSSCCIVATSTQGSVLPAWSAPREAPDGGLFAVRRHLWGSHGNSSFPEFFHNMDYFKYHNMRPPFTYATLIRWAILEAPERQRTLNEIYHWFTRMFAYFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDEFEFRKKRSQRPNKCSNPCP rorg_mouse Nuclear receptor ROR-gamma Rorc Nr1f3 Rorg Thor Nuclear receptor RZR-gamma Nuclear receptor subfamily 1 group F member 3 Retinoid-related orphan receptor-gamma Thymus orphan receptor RAR-related orphan receptor C protein protein mouse Mus musculus Mouse MDRAPQRHHRTSRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQCNVAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLGLSDGQLPLGASPDLPEASACPPGLLRASGSGPPYSNTLAKTEVQGASCHLEYSPERGKAEGRDSIYSTDGQLTLGRCGLRFEETRHPELGEPEQGPDSHCIPSFCSAPEVPYASLTDIEYLVQNVCKSFRETCQLRLEDLLRQRTNLFSREEVTSYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIILLTAGAMEVVLVRMCRAYNANNHTVFFEGKYGGVELFRALGCSELISSIFDFSHFLSALCFSEDEIALYTALVLINANRPGLQEKRRVEHLQYNLELAFHHHLCKTHRQGLLAKLPPKGKLRSLCSQHVEKLQIFQHLHPIVVQAAFPPLYKELFSTDVESPEGLSK rorc-foxp3-1 1861077 N/A 1861081 unspecified role unspecified role prey prey region foxp3hu required to bind necessary binding region required to bind range range range range false N/A 1861082 unspecified role unspecified role bait bait n-terminus ROR flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 3B foxp3-rorc-2 1861077 N/A 1861083 unspecified role unspecified role prey prey N/A 1861084 unspecified role unspecified role bait bait n-terminus foxp3 flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region foxp3 required to bind necessary binding region required to bind range range range range false physical association physical association false false false Fig. 3A rorg-foxp3-1 1861078 N/A 1861084 unspecified role unspecified role neutral component neutral component n-terminus foxp3 flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1861083 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Supplementary Fig. 4. FKH mutant remained in the cytoplasm even when it was co-expressed with ROR-gamma-t foxp3-rorc-1 1861079 N/A 1861083 unspecified role unspecified role neutral component neutral component N/A 1861084 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 1A, Suppementary Fig. 1A TGF-beta causes expression of the gamma-t isoform of ROR-gamma-t foxp3-rorc-3 1861080 N/A 1861084 unspecified role unspecified role neutral component neutral component N/A 1861085 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Supplementary Fig. 1B