IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ onica-2008-5 Dexamethasone-mediated up-regulation of human CYP2A6 involves the glucocorticoid receptor and increased binding of hepatic nuclear factor 4 alpha to the proximal promoter. human-hepatocytes Human-hepatocytes primary hepatocytes primary hepatocytes ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Onica T., Nichols K., Larin M., Ng L., Maslen A., Dvorak Z., Pascussi J.M., Vilarem M.J., Maurel P., Kirby G.M. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis gkirby@uoguelph.ca Mol. Pharmacol. (0026-895X) 2008 Only protein-protein interactions imex curation IBD - Inflammatory bowel disease onica-2008-1 Dexamethasone-mediated up-regulation of human CYP2A6 involves the glucocorticoid receptor and increased binding of hepatic nuclear factor 4 alpha to the proximal promoter. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Onica T., Nichols K., Larin M., Ng L., Maslen A., Dvorak Z., Pascussi J.M., Vilarem M.J., Maurel P., Kirby G.M. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis gkirby@uoguelph.ca Mol. Pharmacol. (0026-895X) 2008 Only protein-protein interactions imex curation IBD - Inflammatory bowel disease onica-2008-2 Dexamethasone-mediated up-regulation of human CYP2A6 involves the glucocorticoid receptor and increased binding of hepatic nuclear factor 4 alpha to the proximal promoter. human-hepatocytes Human-hepatocytes primary hepatocytes primary hepatocytes anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Onica T., Nichols K., Larin M., Ng L., Maslen A., Dvorak Z., Pascussi J.M., Vilarem M.J., Maurel P., Kirby G.M. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis gkirby@uoguelph.ca Mol. Pharmacol. (0026-895X) 2008 Only protein-protein interactions imex curation IBD - Inflammatory bowel disease onica-2008-3 Dexamethasone-mediated up-regulation of human CYP2A6 involves the glucocorticoid receptor and increased binding of hepatic nuclear factor 4 alpha to the proximal promoter. in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Onica T., Nichols K., Larin M., Ng L., Maslen A., Dvorak Z., Pascussi J.M., Vilarem M.J., Maurel P., Kirby G.M. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis gkirby@uoguelph.ca Mol. Pharmacol. (0026-895X) 2008 Only protein-protein interactions imex curation IBD - Inflammatory bowel disease onica-2008-4 Dexamethasone-mediated up-regulation of human CYP2A6 involves the glucocorticoid receptor and increased binding of hepatic nuclear factor 4 alpha to the proximal promoter. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Onica T., Nichols K., Larin M., Ng L., Maslen A., Dvorak Z., Pascussi J.M., Vilarem M.J., Maurel P., Kirby G.M. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis gkirby@uoguelph.ca Mol. Pharmacol. (0026-895X) 2008 Only protein-protein interactions imex curation IBD - Inflammatory bowel disease onica-2008-6 Dexamethasone-mediated up-regulation of human CYP2A6 involves the glucocorticoid receptor and increased binding of hepatic nuclear factor 4 alpha to the proximal promoter. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Onica T., Nichols K., Larin M., Ng L., Maslen A., Dvorak Z., Pascussi J.M., Vilarem M.J., Maurel P., Kirby G.M. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis ChIP signals for proteins that bind indirectly to DNA were improved by incubating cells with the homobifunctional, cleavable cross-linking reagent DTBP (dimethyl-3,3-dithiobispropionimidate-2HCl) on ice for 30 minutes. gkirby@uoguelph.ca Mol. Pharmacol. (0026-895X) 2008 Only protein-protein interactions imex curation IBD - Inflammatory bowel disease hnf4a_human Hepatocyte nuclear factor 4-alpha Transcription factor HNF-4 Nuclear receptor subfamily 2 group A member 1 Transcription factor 14 HNF4A HNF4 NR2A1 TCF14 protein protein human Homo sapiens Human MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI cp2a6_human_gene Cytochrome P450 2A6 (CP2A6) human gene gene gene human Homo sapiens Human h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG gcr_human Glucocorticoid receptor Nuclear receptor subfamily 3 group C member 1 NR3C1 GRL protein protein human Homo sapiens Human MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVGSENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK cp2a6_human_hnf4a-site_dna-probe Human CP2A6 gene promoter HNF4a response element DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human GTTGGGAGGTGAAATGAGGTAAT hnf4a-cp2a6 1597597 n/a 1597603 unspecified role unspecified role bait bait n/a 1597604 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 7a dexamethasone (CHEBI:41879), a synthetic glucocorticoid No CP2A6 promoter DNA was co-precipitated with anti-HNF4alpha antibody from cells not treated with the synthetic glucocorticoid dexamethasone (CHEBI:41879). P41235 increases expression at RNA level of ENSG00000255974 CHEBI:41879 increases binding of P41235 to ENSG00000255974 hist1h4a-cp2a6 1597597 n/a 1597605 unspecified role unspecified role bait bait possible acetyllys naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1597604 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 7a dexamethasone (CHEBI:41879), a synthetic glucocorticoid No CP2A6 promoter DNA was co-precipitated with anti-acetyl-H4 antibody from cells not treated with the synthetic glucocorticoid dexamethasone (CHEBI:41879). CHEBI:41879 increases binding of P62805 to ENSG00000255974 nr3c1-hnf4a 1597598 n/a 1597606 unspecified role unspecified role bait bait n/a 1597603 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5b dexamethasone (CHEBI:41879), a synthetic glucocorticoid nr3c1-hnf4a-1 1597599 n/a 1597606 unspecified role unspecified role bait bait n/a 1597603 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5b cp2a6-hnf4a 1597600 n/a 1597603 unspecified role unspecified role prey prey human-hepatocytes Human-hepatocytes primary hepatocytes primary hepatocytes n/a 1597607 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 6a cp2a6-hnf4a-1 1597601 n/a 1597606 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 n/a 1597603 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 n/a 1597607 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 6b dexamethasone (CHEBI:41879), a synthetic glucocorticoid Two isoforms of glucocorticoid receptor (GR) were detected by the anti-GR antibody, one around 90 kilodaltons (called beta) and one around 94 kilodaltons (called alpha). nr3c1-cp2a6 1597602 n/a 1597606 unspecified role unspecified role bait bait n/a 1597604 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 7b dexamethasone (CHEBI:41879), a synthetic glucocorticoid No CP2A6 promoter DNA was co-precipitated with anti-GR antibody from cells not treated with the synthetic glucocorticoid dexamethasone (CHEBI:41879). CHEBI:41879 increases binding of P04150 to ENSG00000255974