IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ferguson-2005-2 Human CYP2C8 is transcriptionally regulated by the nuclear receptors constitutive androstane receptor, pregnane X receptor, glucocorticoid receptor, and hepatic nuclear factor 4alpha. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa autoradiography autoradiography Ferguson S.S., Chen Y., LeCluyse E.L., Negishi M., Goldstein J.A. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis The molecule "RXR" has been entered as RXRA, as this was the molecule detected in figure 5. It has been assumed to have been used elsewhere in this publication. goldste1@niehs.nih.gov Mol. Pharmacol. (0026-895X) 2005 Only protein-protein interactions imex curation IBD - Inflammatory bowel disease ferguson-2005-1 Human CYP2C8 is transcriptionally regulated by the nuclear receptors constitutive androstane receptor, pregnane X receptor, glucocorticoid receptor, and hepatic nuclear factor 4alpha. in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Ferguson S.S., Chen Y., LeCluyse E.L., Negishi M., Goldstein J.A. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis The molecule "RXR" has been entered as RXRA, as this was the molecule detected in figure 5. It has been assumed to have been used elsewhere in this publication. goldste1@niehs.nih.gov Mol. Pharmacol. (0026-895X) 2005 Only protein-protein interactions imex curation IBD - Inflammatory bowel disease hnf4a_human Hepatocyte nuclear factor 4-alpha Transcription factor HNF-4 Nuclear receptor subfamily 2 group A member 1 Transcription factor 14 HNF4A HNF4 NR2A1 TCF14 protein protein human Homo sapiens Human MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI cp2c8_human_hnf4a-site_dna-probe Human CP2C8 gene promoter HNF4-alpha binding site (-154) DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human CATGGGCCAAAGTCCACTC nr1i3_human Nuclear receptor subfamily 1 group I member 3 NR1I3 CAR Constitutive androstane receptor Constitutive activator of retinoid response Orphan nuclear receptor MB67 protein protein human Homo sapiens Human MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAGSCEVSKTQRRHCPACRLQKCLDAGMRKDMILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLPVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDGARVSPTVGFQVEFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRDEIDQLQEEMALTLQSYIKGQQRRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS cp2c8_human_dr4-site_dna-probe Human CP2C8 gene promoter distal/-8806 DR-4 element DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human AGTCAACTTTGATGACCCCA rxra_human Retinoic acid receptor RXR-alpha RXRA NR2B1 Retinoid X receptor alpha Nuclear receptor subfamily 2 group B member 1 protein protein human Homo sapiens Human MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT nr1i2_human Nuclear receptor subfamily 1 group I member 2 NR1I2 PXR Orphan nuclear receptor PAR1 Orphan nuclear receptor PXR Pregnane X receptor Steroid and xenobiotic receptor protein protein human Homo sapiens Human MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS cp2c8_human_dr5-site_dna-probe Human CP2C8 gene promoter proximal/-2796 DR-5 element DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human AGTAAACCCTATGTGAACTTC cp2c9_human_car-re_dna-probe Human CP2C9 gene promoter CAR response element proximal/-1839 DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human AACCAAACTCTTCTGACCTCTC cp2c8-hnf4a-1 1771478 n/a 1771480 unspecified role unspecified role prey prey in vitro In vitro n/a 1771481 unspecified role unspecified role bait bait dctp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 10a cp2c8-cp2c8 1771478 n/a 1771480 unspecified role unspecified role prey prey in vitro In vitro n/a 1771481 unspecified role unspecified role bait bait dctp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1771481 competitor competitor competitor prey prey c8g_a9t_a10t_a11t_g12c_t13a mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 10a cp2c8-nr1i3 1771478 n/a 1771482 unspecified role unspecified role prey prey in vitro In vitro n/a 1771483 unspecified role unspecified role bait bait dctp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1771484 unspecified role unspecified role prey prey in vitro In vitro association association false false false Fig. 4, 5 cp2c8-cp2c8-1 1771478 n/a 1771482 unspecified role unspecified role prey prey in vitro In vitro n/a 1771484 unspecified role unspecified role prey prey in vitro In vitro n/a 1771483 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1771483 unspecified role unspecified role bait bait dctp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 4, 5 cp2c8-cp2c8-2 1771478 n/a 1771485 unspecified role unspecified role prey prey in vitro In vitro n/a 1771484 unspecified role unspecified role prey prey in vitro In vitro n/a 1771483 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1771483 unspecified role unspecified role bait bait dctp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 4, 5 cp2c8-nr1i2 1771478 n/a 1771483 unspecified role unspecified role bait bait dctp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1771484 unspecified role unspecified role prey prey in vitro In vitro n/a 1771485 unspecified role unspecified role prey prey in vitro In vitro association association false false false Fig. 4, 5 cp2c8-nr1i2-1 1771478 n/a 1771485 unspecified role unspecified role prey prey in vitro In vitro n/a 1771486 unspecified role unspecified role bait bait dctp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1771484 unspecified role unspecified role prey prey in vitro In vitro association association false false false Fig. 5 cp2c8-cp2c8-3 1771478 n/a 1771486 unspecified role unspecified role bait bait dctp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1771484 unspecified role unspecified role prey prey in vitro In vitro n/a 1771486 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1771485 unspecified role unspecified role prey prey in vitro In vitro association association false false false Fig. 5 cp2c8-cp2c8-4 1771478 n/a 1771482 unspecified role unspecified role prey prey in vitro In vitro n/a 1771484 unspecified role unspecified role prey prey in vitro In vitro n/a 1771486 unspecified role unspecified role bait bait dctp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1771486 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 5 cp2c8-nr1i3-1 1771478 n/a 1771482 unspecified role unspecified role prey prey in vitro In vitro n/a 1771486 unspecified role unspecified role bait bait dctp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1771484 unspecified role unspecified role prey prey in vitro In vitro association association false false false Fig. 5 cp2c9-nr1i3 1771478 n/a 1771482 unspecified role unspecified role prey prey in vitro In vitro n/a 1771487 unspecified role unspecified role bait bait dctp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1771484 unspecified role unspecified role prey prey in vitro In vitro association association false false false Fig. 2 cp2c9-cp2c9-2 1771478 n/a 1771482 unspecified role unspecified role prey prey in vitro In vitro n/a 1771484 unspecified role unspecified role prey prey in vitro In vitro n/a 1771487 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1771487 unspecified role unspecified role bait bait dctp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 2 cp2c9-cp2c9-3 1771478 n/a 1771484 unspecified role unspecified role prey prey in vitro In vitro n/a 1771485 unspecified role unspecified role prey prey in vitro In vitro n/a 1771487 unspecified role unspecified role bait bait dctp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1771487 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 2 cp2c9-nr1i2 1771478 n/a 1771487 unspecified role unspecified role bait bait dctp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1771485 unspecified role unspecified role prey prey in vitro In vitro n/a 1771484 unspecified role unspecified role prey prey in vitro In vitro association association false false false Fig. 2 cp2c8-rxra 1771479 n/a 1771484 unspecified role unspecified role prey prey in vitro In vitro n/a 1771486 unspecified role unspecified role bait bait dctp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 5 cp2c8-rxra-1 1771479 n/a 1771483 unspecified role unspecified role bait bait dctp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1771484 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false Fig. 5 cp2c8-hnf4a 1771479 n/a 1771480 unspecified role unspecified role prey prey in vitro In vitro n/a 1771481 unspecified role unspecified role bait bait dctp 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 10a P41235 increases expression at RNA level of ENSG00000138115