IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kyttaris-2004-2 Cyclic adenosine 5'-monophosphate response element modulator is responsible for the decreased expression of c-fos and activator protein-1 binding in T cells from patients with systemic lupus erythematosus. in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Kyttaris V.C., Juang Y.T., Tenbrock K., Weinstein A., Tsokos G.C. IBD - Inflammatory bowel disease gtsokos@usuhs.mil J. Immunol. (0022-1767) 2004 Only protein-protein interactions imex curation kyttaris-2004-1 Cyclic adenosine 5'-monophosphate response element modulator is responsible for the decreased expression of c-fos and activator protein-1 binding in T cells from patients with systemic lupus erythematosus. human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Kyttaris V.C., Juang Y.T., Tenbrock K., Weinstein A., Tsokos G.C. IBD - Inflammatory bowel disease FOS promoter DNA also co-precipitated with anti-CREB antibody and this interaction was increased in T cells from healthy individuals compared to T cells from SLE patients; however, the exact identity of the targeted CREB protein could not be established, hence this interaction was not captured here. gtsokos@usuhs.mil J. Immunol. (0022-1767) 2004 Only protein-protein interactions imex curation crem_human cAMP-responsive element modulator CREM Inducible cAMP early repressor protein protein human Homo sapiens Human MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVSVAGSGTRRGSPAVTLVQLPSGQTIHVQGVIQTPQPWVIQSSEIHTVQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAPSHMAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY fos_human_cre-site_dna-probe Human FOS gene promoter cAMP response element DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human GAGCCCGTGACGTTTACACTCA fos_human Proto-oncogene c-Fos Cellular oncogene fos G0/G1 switch regulatory protein 7 FOS G0S7 protein protein human Homo sapiens Human MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL ap1-consensus_dna-probe AP-1 consensus binding sequence DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) CGCTTGATGACTCAGCCGGAA jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF fos_human_gene Human FOS gene gene gene human Homo sapiens Human fos-crem-1 1767909 n/a 1767911 unspecified role unspecified role prey prey human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes n/a 1767912 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 2 Nuclear extracts were prepared from unstimulated T cells from healthy individuals and T cells from SLE patients. The interaction was increased when SLE T cell nuclear extracts were used. Supershift was also observed when an anti-CREB antibody was used; however, the exact identity of the targeted CREB protein could not be established, hence this interaction was not captured here. ap1_consensus-fos-1 1767909 n/a 1767913 unspecified role unspecified role prey prey human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes n/a 1767914 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 6a ap1_consensus-jun-1 1767909 n/a 1767914 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1767915 unspecified role unspecified role prey prey human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes physical association physical association false false false Fig. 6a crem-fos-2 1767910 n/a 1767911 unspecified role unspecified role bait bait n/a 1767916 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 1a, 1b, 1c Chromatin immunoprecipitation was performed with unstimulated T cells from healthy individuals and T cells from SLE patients. The interaction was significantly increased in the latter. Q03060 decreases expression at RNA level of ENSG00000170345