UniProt UniProt http://www.uniprot.org guo-2014-24 mouse-STHdhQ7/Q7 mouse STHdhQ7/Q7 sthdhq7/q7 STHdhQ7/Q7 mouse (brain)- striatal derived cell line from a knock in transgenic mouse containing homozygous Huntingtin (HTT) loci with a humanized Exon 1 containing 7 polyglutamine repeats. CVCL_M590 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Nature communications 2014 Only protein-protein interactions imex curation imex curation guo-2014-25 mouse-STHdhq111/q111 immortalised embryonic striatal cells with humanised HTT Exon 1 and 111 CAG repeats sthdhq111 STHdh Q111/Q111 https://www.coriell.org/0/sections/Search/Sample_Detail.aspx?Ref=CH00095&PgId=166 Coriell Cell Repositories;CH00095 Cellosaurus STHdhQ111 (CVCL_M591) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Nature communications 2014 Only protein-protein interactions imex curation imex curation guo-2014-35 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Nature communications 2014 Only protein-protein interactions imex curation imex curation guo-2014-37 mouse-STHdhq111/q111 immortalised embryonic striatal cells with humanised HTT Exon 1 and 111 CAG repeats sthdhq111 STHdh Q111/Q111 https://www.coriell.org/0/sections/Search/Sample_Detail.aspx?Ref=CH00095&PgId=166 Coriell Cell Repositories;CH00095 Cellosaurus STHdhQ111 (CVCL_M591) crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease Crosslinking agent - DSP (dithiobis(succinimidyl propionate)) or formaldehyde xxq38@case.edu Nature communications 2014 Only protein-protein interactions imex curation imex curation guo-2014-26 mouse-striatum Mus musculus, striatum striatum striatum anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Nature communications 2014 Only protein-protein interactions imex curation imex curation guo-2014-30 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Nature communications 2014 Only protein-protein interactions imex curation imex curation guo-2014-33 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Nature communications 2014 Only protein-protein interactions imex curation imex curation guo-2014-36 mouse-STHdhQ7/Q7 mouse STHdhQ7/Q7 sthdhq7/q7 STHdhQ7/Q7 mouse (brain)- striatal derived cell line from a knock in transgenic mouse containing homozygous Huntingtin (HTT) loci with a humanized Exon 1 containing 7 polyglutamine repeats. CVCL_M590 crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease Crosslinking agent - DSP (dithiobis(succinimidyl propionate)) xxq38@case.edu Nature communications 2014 Only protein-protein interactions imex curation imex curation guo-2014-23 human-ips Human- induced pluripotent stem cells ips cells Induced pluripotent stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip sequence tag sequence tag identification sequence tag Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease iPS cells from a HD patient (carrying 41 CAG repeats) were differentiated into neurons prior to affinity purification of the complex xxq38@case.edu Nature communications 2014 Only protein-protein interactions imex curation imex curation guo-2014-27 mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Nature communications 2014 Only protein-protein interactions imex curation imex curation guo-2014-28 human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast Resident cell of connective tissue, mesodermally derived anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Nature communications 2014 Only protein-protein interactions imex curation imex curation guo-2014-29 human-brain-caudate_nucleus Human brain, caudate nuclear region brain-caudate_nucleus caudate nucleus anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Nature communications 2014 Only protein-protein interactions imex curation imex curation guo-2014-31 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Nature communications 2014 Only protein-protein interactions imex curation imex curation guo-2014-32 in vitro In vitro comigration in gel comigration in gel electrophoresis comigration in gel anti tag western anti tag western blot anti tag western Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease iPS cells from a HD patient (carrying 41 CAG repeats) were differentiated into neurons prior to affinity purification of the complex xxq38@case.edu Nature communications 2014 Only protein-protein interactions imex curation imex curation guo-2014-34 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Nature communications 2014 Only protein-protein interactions imex curation imex curation guo-2014-38 mouse-striatum Mus musculus, striatum striatum striatum anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease R6/2 mice which are transgenic for the 5-prime end of the human HD gene carrying 100–150 glutamine (CAG) repeats. xxq38@case.edu Nature communications 2014 Only protein-protein interactions imex curation imex curation guo-2014-39 human-brain-cortex Homo sapiens brain cortex brain_cortex Brain cortex [Cerebral cortex; Cerebrum cortex; Cortex; Pallium] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo X., Sesaki H., Qi X., Zhao Y., Sun X., Hu D., Prosdocimo DA., Hoppel C., Jain MK., Ramachandran R., Qi X. Huntington's - Publications describing interactions involved in Huntington's disease xxq38@case.edu Nature communications 2014 Only protein-protein interactions imex curation imex curation atad3_mouse ATPase family AAA domain-containing protein 3 AAA-ATPase TOB3 Atad3 Atad3a Kiaa1273 protein protein mouse Mus musculus Mouse MSWLFGIKGPKGEGTGPPLPLPPAQPGAEGGGDRGAGDRPSPKDKWSNFDPTGLERAAKAARELEHSRHAKEALSLAQMQEQTLQLEQQSKLKEYEAAVEQLKSEQIRVQAEERRKTLTEETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEAIRRATVEREMELRHKNEMLRVEAEARARAKADRENADIIREQIRLKAAEHRQTILESIRTAGTLLGEGFRAFVTDWDKVTATVAGLTLLAVGVYSAKNATSVAGRYIEARLGKPSLVRETSRISVLEALRHPIQVSRRLVSRPQDALEGVILSPSLEARVRDIAIATRNTKKNKSLYRNVLMYGPPGTGKTLFAKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKVFDWASTSRRGLLLFVDEADAFLRKRATEKISEDLRATLNAFLHRTGQHSSKFMLVLASNQPEQFDWAINDRIDEMVCFALPQREERERLVRMYFDKYVLKPATEGKQRLKVAQFDYGKKCSEVAQLTEGMSGREIAQLAVAWQAMAYSSEDGVLTEAMMDARVQDAVQQHQQKMQWLKVERPDSQTNKPPHPSLLSC dnm1l_mouse Dynamin-1-like protein Dnm1l Drp1 Dynamin-related protein 1 Dynamin family member proline-rich carboxyl-terminal domain less protein protein mouse Mus musculus Mouse MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVHVSPEDKRKTTGEENGKFQSWRVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAGSRDKSSKVPSALAPASQEPPPAASAEADGKLIQDNRRETKNVPSAGGGIGDGGQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW mff_mouse Mitochondrial fission factor Mff protein protein mouse Mus musculus Mouse MAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQEFQDGVPNASVIMQVPERIVVTGNNEDISFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPLPTPQSEESRAVGRLKRERSMSENAVRQNGQLVRNDSIVTPSPPQARVCPPHMLPEDGANLSSARGILSLIQSSTRRAYQQILDVLDENRRPVLRGGSAAATSNPHHDNVRYGISNLDAAIEGASDDMTVVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLWFRR fis1_mouse Mitochondrial fission 1 protein Fis1 Ttc11 FIS1 homolog Tetratricopeptide repeat protein 11 protein protein mouse Mus musculus Mouse MEAVLNELVSVEDLKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSKYNEDIRRGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS Promotes the fragmentation of the mitochondrial network and its perinuclear clustering. Can induce cytochrome c release from the mitochondrion to the cytosol, ultimately leading to apoptosis. Also mediates peroxisomal fission mint mid51_mouse Mitochondrial dynamics protein MID51 Mief1 Mid51 Smcr7l Mitochondrial dynamics protein of 51 kDa homolog Mitochondrial elongation factor 1 Smith-Magenis syndrome chromosomal region candidate gene 7 protein-like protein protein mouse Mus musculus Mouse MAGAGERKGKKDDNGIGTAIDFVLSNARLVLGVGGAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLNKDMKAGLSRSLQTLPTDSSAFDTDTFCPPRPKPLARRGQVDLKKSRLRMSLQEKLLSYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYEKDKHLVIDFLPSVTLGDTVLVARPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPQEIDELGYTLYCSLSEPEVLLQT q9nvi7-2 ATPase family AAA domain-containing protein 3A ATAD3A protein protein human Homo sapiens Human MSWLFGINKGPKGEGAGPPPPLPPAQPGAEGGGDRGLGDRPAPKDKWSNFDPTGLERAAKAARELEHSRYAKDALNLAQMQEQTLQLEQQSKLKEYEAAVEQLKSEQIRAQAEERRKTLSEETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEAMRRATVEREMELRHKNEMLRVEAEARARAKAERENADIIREQIRLKAAEHRQTVLESIRTAGTLFGEGFRAFVTDWDKVTATVAGLTLLAVGVYSAKNATLVAGRFIEARLGKPSLVRETSRITVLEALRHPIQVSRRLLSRPQDALEGVVLSPSLEARVRDIAIATRNTKKNRSLYRNILMYGPPGTGKTLFAKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKLFDWANTSRRGLLLFVDEADAFLRKRATEKISEDLRATLNAFLYRTGQHSNKFMLVLASNQPEQFDWAINDRINEMVHFDLPGQEERERLVRMYFDKYVLKPATEGKQRLKLAQFDYGRKCSEVARLTEGMSGREIAQLAVSWQATAYASEDGVLTEAMMDTRVQDAVQQHQQKMCWLKAEGPGRGDEPSPS May be the predominant ATAD3A form. Variant in position: 53:T->I (in HAYOS) (Ref.19). Variant in position: 528:R->W (in HAYOS) (Ref.19). dnm1l_human Dynamin-1-like protein Dynamin-like protein Dnm1p/Vps1p-like protein Dynamin family member proline-rich carboxyl-terminal domain less Dynamin-related protein 1 Dynamin-like protein 4 Dynamin-like protein IV DNM1L DLP1 DRP1 protein protein human Homo sapiens Human MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW F9521A376B785B71 bcl7c_human B-cell CLL/lymphoma 7 protein family member C BCL7C protein protein human Homo sapiens Human MAGRTVRAETRSRAKDDIKKVMATIEKVRRWEKRWVTVGDTSLRIFKWVPVVDPQEEERRRAGGGAERSRGRERRGRGASPRGGGPLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPVSPAGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLTKEEPVPELLEAEAPEAYPVFEPVPPVPEAAQGDTEDSEGAPPLKRICPNAPDP mint homomint May play an anti-apoptotic role atd3a_human ATPase family AAA domain-containing protein 3A ATAD3A protein protein human Homo sapiens Human MSWLFGINKGPKGEGAGPPPPLPPAQPGAEGGGDRGLGDRPAPKDKWSNFDPTGLERAAKAARELEHSRYAKDALNLAQMQEQTLQLEQQSKLKMRLEALSLLHTLVWAWSLCRAGAVQTQERLSGSASPEQVPAGECCALQEYEAAVEQLKSEQIRAQAEERRKTLSEETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEAMRRATVEREMELRHKNEMLRVEAEARARAKAERENADIIREQIRLKAAEHRQTVLESIRTAGTLFGEGFRAFVTDWDKVTATVAGLTLLAVGVYSAKNATLVAGRFIEARLGKPSLVRETSRITVLEALRHPIQVSRRLLSRPQDALEGVVLSPSLEARVRDIAIATRNTKKNRSLYRNILMYGPPGTGKTLFAKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKLFDWANTSRRGLLLFVDEADAFLRKRATEKISEDLRATLNAFLYRTGQHSNKFMLVLASNQPEQFDWAINDRINEMVHFDLPGQEERERLVRMYFDKYVLKPATEGKQRLKLAQFDYGRKCSEVARLTEGMSGREIAQLAVSWQATAYASEDGVLTEAMMDTRVQDAVQQHQQKMCWLKAEGPGRGDEPSPS prdx3_human Thioredoxin-dependent peroxide reductase, mitochondrial Peroxiredoxin-3 Peroxiredoxin III Antioxidant protein 1 Protein MER5 homolog HBC189 PRDX3 AOP1 Thioredoxin-dependent peroxiredoxin 3 protein protein human Homo sapiens Human MAAAVGRLLRASVARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSCHAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQKVNQ vdac2_human Voltage-dependent anion-selective channel protein 2 VDAC2 Outer mitochondrial membrane protein porin 2 protein protein human Homo sapiens Human MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA adt2_human ADP/ATP translocase 2 SLC25A5 ANT2 Adenine nucleotide translocator 2 ADP,ATP carrier protein 2 Solute carrier family 25 member 5 ADP,ATP carrier protein, fibroblast isoform AAC2 protein protein human Homo sapiens Human MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWLYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYT mk01_human Mitogen-activated protein kinase 1 MAPK1 ERK2 PRKM1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 PRKM2 protein protein human Homo sapiens Human MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS kcru_human Creatine kinase U-type, mitochondrial Ubiquitous mitochondrial creatine kinase Acidic-type mitochondrial creatine kinase CKMT1A CKMT CKMT1B protein protein human Homo sapiens Human MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH pp2aa_human Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform PPP2CA Replication protein C protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL odb2_human Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial DBT BCATE2 Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase Dihydrolipoamide branched chain transacylase Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex Branched-chain alpha-keto acid dehydrogenase complex component E2 52 kDa mitochondrial autoantigen of primary biliary cirrhosis Branched chain 2-oxo-acid dehydrogenase complex component E2 protein protein human Homo sapiens Human MAAVRMLRTWSRNAGKLICVRYFQTCGNVHVLKPNYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVGQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK bckd_human [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial Branched-chain alpha-ketoacid dehydrogenase kinase BCKDK protein protein human Homo sapiens Human MILASVLRSGPGGGLPLRPLLGPALALRARSTSATDTHHVEMARERSKTVTSFYNQSAIDAAAEKPSVRLTPTMMLYAGRSQDGSHLLKSARYLQQELPVRIAHRIKGFRCLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLDDHKDVVTLLAEGLRESRKHIEDEKLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARRLCEHKYGNAPRVRINGHVAARFPFIPMPLDYILPELLKNAMRATMESHLDTPYNVPDVVITIANNDVDLIIRISDRGGGIAHKDLDRVMDYHFTTAEASTQDPRISPLFGHLDMHSGAQSGPMHGFGFGLPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLRHIDGREESFRI odo2_human Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial DLST DLTS Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex E2K 2-oxoglutarate dehydrogenase complex component E2 protein protein human Homo sapiens Human MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL hs71l_human Heat shock 70 kDa protein 1-like HSPA1L Heat shock 70 kDa protein 1-Hom protein protein human Homo sapiens Human MATAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKNALESYAFNMKSVVSDEGLKGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD hsp72_human Heat shock-related 70 kDa protein 2 HSPA2 protein protein human Homo sapiens Human MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGETKTFFPEEISSMVLTKMKEIAEAYLGGKVHSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAAAIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEEVD hspa1a_hspa1b_human-1 HSPA1A_HSPA1B_human molecule set molecule set human Homo sapiens Human P0DMV8,P0DMV9 grp75_human Stress-70 protein, mitochondrial HSPA9 GRP75 HSPA9B 75 kDa glucose-regulated protein Heat shock 70 kDa protein 9 Peptide-binding protein 74 Mortalin mt-HSP70 protein protein human Homo sapiens Human MISASRAAAARLVGAAASRGPTAARHQDSWNGLSHEAFRLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSEDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLTKDNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ atpk_human ATP synthase subunit f, mitochondrial ATP5MF ATP synthase membrane subunit f ATP5J2 ATP5JL protein protein human Homo sapiens Human MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH atp5l_human ATP synthase subunit g, mitochondrial ATP5MG ATP synthase membrane subunit g ATP5L protein protein human Homo sapiens Human MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV qcr2_human Cytochrome b-c1 complex subunit 2, mitochondrial Ubiquinol-cytochrome-c reductase complex core protein 2 Core protein II Complex III subunit 2 UQCRC2 protein protein human Homo sapiens Human MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL atpg_human ATP synthase subunit gamma, mitochondrial ATP5F1C ATP synthase F1 subunit gamma ATP5C ATP5C1 ATP5CL1 F-ATPase gamma subunit protein protein human Homo sapiens Human MFSRAGVAGLSAWTLQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARIYGLGSLALYEKADIKGPEDKKKHLLIGVSSDRGLCGAIHSSIAKQMKSEVATLTAAGKEVMLVGIGDKIRGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVASADSMSIYDDIDADVLQNYQEYNLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALD at5f1_human ATP synthase F(0) complex subunit B1, mitochondrial ATP5PB ATP synthase peripheral stalk-membrane subunit b ATP synthase proton-transporting mitochondrial F(0) complex subunit B1 ATP synthase subunit b ATP5F1 protein protein human Homo sapiens Human MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM kpym_human Pyruvate kinase PKM PKM Cytosolic thyroid hormone-binding protein OIP3 Opa-interacting protein 3 PK2 PK3 PKM2 Pyruvate kinase 2/3 Pyruvate kinase muscle isozyme Thyroid hormone-binding protein 1 Tumor M2-PK p58 protein protein human Homo sapiens Human MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP atp5h_human ATP synthase subunit d, mitochondrial ATP5PD ATP synthase peripheral stalk subunit d ATP5H My032 protein protein human Homo sapiens Human MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL echb_human Trifunctional enzyme subunit beta, mitochondrial HADHB MSTP029 TP-beta protein protein human Homo sapiens Human MTILTYPFKNLPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRPSSLEQMAKLKPAFIKPYGTVTAANSSFLTDGASAMLIMAEEKALAMGYKPKAYLRDFMYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAENYMGRKTKVGLPPLEKFNNWGGSLSLGHPFGATGCRLVMAAANRLRKEGGQYGLVAACAAGGQGHAMIVEAYPK c1qbp_human Complement component 1 Q subcomponent-binding protein, mitochondrial C1QBP GC1QBP HABP1 SF2P32 Glycoprotein gC1qBP Hyaluronan-binding protein 1 Mitochondrial matrix protein p32 p33 ASF/SF2-associated protein p32 gC1q-R protein protein protein human Homo sapiens Human MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ tfam_human Transcription factor A, mitochondrial TCF6 Mitochondrial transcription factor 1 Transcription factor 6-like 2 TFAM TCF6L2 Transcription factor 6 protein protein human Homo sapiens Human MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC dnja3_human DnaJ homolog subfamily A member 3, mitochondrial DNAJA3 TID1 HCA57 Tumorous imaginal discs protein Tid56 homolog DnaJ protein Tid-1 Hepatocellular carcinoma-associated antigen 57 protein protein human Homo sapiens Human MAARCSTRWLLVVVGTPRLPAISGRGARPPREGVVGAWLSRKLSVPAFASSLTSCGPRALLTLRPGVSLTGTKHNPFICTASFHTSAPLAKEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGSAGFDPGASGSQHSYWKGGPTVDPEELFRKIFGEFSSSSFGDFQTVFDQPQEYFMELTFNQAAKGVNKEFTVNIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRSTCRRCGGRGSIIISPCVVCRGAGQAKQKKRVMIPVPAGVEDGQTVRMPVGKREIFITFRVQKSPVFRRDGADIHSDLFISIAQALLGGTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYGYGDHYIHIKIRVPKRLTSRQQSLILSYAEDETDVEGTVNGVTLTSSGGSTMDSSAGSKARREAGEDEEGFLSKLKKMFTS rpab1_human DNA-directed RNA polymerases I, II, and III subunit RPABC1 POLR2E DNA-directed RNA polymerase II subunit E RPB5 homolog DNA-directed RNA polymerase II 23 kDa polypeptide XAP4 protein protein human Homo sapiens Human MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ ptcd3_human Pentatricopeptide repeat domain-containing protein 3, mitochondrial Transformation-related gene 15 protein TRG15 28S ribosomal protein S39, mitochondrial MRPS39 PTCD3 Mitochondrial small ribosomal subunit protein mS39 protein protein human Homo sapiens Human MAVVSAVRWLGLRSRLGQPLTGRRAGLCEQARSCRFYSGSATLSKVEGTDVTGIEEVVIPKKKTWDKVAVLQALASTVNRDTTAVPYVFQDDPYLMPASSLESRSFLLAKKSGENVAKFIINSYPKYFQKDIAEPHIPCLMPEYFEPQIKDISEAALKERIELRKVKASVDMFDQLLQAGTTVSLETTNSLLDLLCYYGDQEPSTDYHFQQTGQSEALEEENDETSRRKAGHQFGVTWRAKNNAERIFSLMPEKNEHSYCTMIRGMVKHRAYEQALNLYTELLNNRLHADVYTFNALIEATVCAINEKFEEKWSKILELLRHMVAQKVKPNLQTFNTILKCLRRFHVFARSPALQVLREMKAIGIEPSLATYHHIIRLFDQPGDPLKRSSFIIYDIMNELMGKRFSPKDPDDDKFFQSAMSICSSLRDLELAYQVHGLLKTGDNWKFIGPDQHRNFYYSKFFDLICLMEQIDVTLKWYEDLIPSAYFPHSQTMIHLLQALDVANRLEVIPKIWKDSKEYGHTFRSDLREEILMLMARDKHPPELQVAFADCAADIKSAYESQPIRQTAQDWPATSLNCIAILFLRAGRTQEAWKMLGLFRKHNKIPRSELLNELMDSAKVSNSPSQAIEVVELASAFSLPICEGLTQRVMSDFAINQEQKEALSNLTALTSDSDTDSSSDSDSDTSEGK atad3-dnm1l-1 3589452 N/A 3589469 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589470 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Immunoprecipitation analysis demonstrated a greater interaction between Drp1 and ATAD3A in HdhQ111 with 111 CAG repeats in the htt gene cells than in HdhQ7 cells with only 7 repeats. Fig. 1C dnm1l-atad3-1 3589452 N/A 3589469 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589470 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Immunoprecipitation analysis demonstrated a greater interaction between Drp1 and ATAD3A in HdhQ111 with 111 CAG repeats in the htt gene cells than in HdhQ7 cells with only 7 repeats. Fig. 1C dnm1l-atad3-11 3589452 N/A 3589469 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589470 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Supp Fig. 7A atad3-dnm1l-2 3589453 N/A 3589469 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589470 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Immunoprecipitation analysis demonstrated a greater interaction between Drp1 and ATAD3A in HdhQ111 with 111 CAG repeats in the htt gene cells than in HdhQ7 cells with only 7 repeats. Fig. 1C dnm1l-atad3-2 3589453 N/A 3589469 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589470 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Immunoprecipitation analysis demonstrated a greater interaction between Drp1 and ATAD3A in HdhQ111 with 111 CAG repeats in the htt gene cells than in HdhQ7 cells with only 7 repeats. Fig. 1C dnm1l-atad3-6 3589453 N/A 3589470 competitor competitor competitor prey prey protein delivery protein delivery region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false tat peptide fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3589469 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589470 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Immunoprecipitation analysis demonstrated a greater interaction between Drp1 and ATAD3A in HdhQ111 with 111 CAG repeats in the htt gene cells than in HdhQ7 cells with only 7 repeats. Fig. 1C, 5D, Supp. 7A dnm1l-atad3a-6 3589454 N/A 3589470 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false tat peptide fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3589469 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level mouse-STHdhQ7/Q7 mouse STHdhQ7/Q7 sthdhq7/q7 STHdhQ7/Q7 mouse (brain)- striatal derived cell line from a knock in transgenic mouse containing homozygous Huntingtin (HTT) loci with a humanized Exon 1 containing 7 polyglutamine repeats. CVCL_M590 direct interaction direct interaction false false false Fig. 5F dnm1l-atad3-8 3589454 N/A 3589470 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false tat peptide fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3589469 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mouse-STHdhq111/q111 immortalised embryonic striatal cells with humanised HTT Exon 1 and 111 CAG repeats sthdhq111 STHdh Q111/Q111 https://www.coriell.org/0/sections/Search/Sample_Detail.aspx?Ref=CH00095&PgId=166 Coriell Cell Repositories;CH00095 Cellosaurus STHdhQ111 (CVCL_M591) direct interaction direct interaction false false false Fig. 5F dnm1l-atad3-10 3589454 N/A 3589470 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false tat peptide fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3589469 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Supp. Fig. 7E dnm1l-mff-2 3589455 N/A 3589471 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589470 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Supp. Fig. 7D fis1-dnm1l-1 3589455 N/A 3589472 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589470 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Supp. Fig. 7D mief1-dnm1l-3 3589455 N/A 3589473 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589470 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Supp. Fig. 7D dnm1l-atad3-3 3589456 N/A 3589469 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589470 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 3-nitropropionic acid (CHEBI:16348) Fig. 1D dnm1l-atad3-9 3589456 N/A 3589470 competitor competitor competitor prey prey protein delivery protein delivery region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false tat peptide fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3589469 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589470 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 3-nitropropionic acid (CHEBI:16348) Fig. 1D, Supp. Fig. 7B dnm1l-atad3a-2 3589457 N/A 3589474 unspecified role unspecified role prey prey purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3589475 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 1H, 5E dnm1l-atad3a-5 3589457 N/A 3589475 competitor competitor competitor prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false tat peptide fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3589474 unspecified role unspecified role prey prey purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3589475 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 5E atad3a-atad3a-1 3589458 N/A 3589474 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9NVI7-2:p.Lys135Gln mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q9NVI7-2:p.Lys135Gln mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3589474 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4D, Supp. Fig. 2G dnm1l-atad3a-7 3589458 N/A 3589474 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9NVI7-2:p.Lys135Gln mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false Q9NVI7-2:p.Lys135Glu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false N/A 3589475 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Supp. Figs. 1G, 6E dnm1l-mff-1 3589459 N/A 3589471 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589470 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Supp. Fig. 7D mief1-dnm1l-4 3589459 N/A 3589473 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589470 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Supp. Fig. 7D dnm1l-10 3589460 N/A 3589476 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589477 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589478 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589479 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589480 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589481 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589482 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589483 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589484 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589485 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589486 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589487 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589488 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589489 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589490 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589491 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589492 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589493 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589494 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589495 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589496 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589497 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589498 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589499 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589500 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589501 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589502 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589503 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589475 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Table 1 dnm1l-atad3-4 3589461 N/A 3589469 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589470 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false ATAD3A preferentially bound to Drp1 in striatal protein lysates of HD YAC128, which exhibit chronic HD-like neurodegeneration with a year-long disease development, and R6/2 mice relative to those of wild-type mice. YAC128 mice contain a full-length human huntingtin gene modified with a 128 CAG repeat expansion in exon 1. R6/2 mice are transgenic for the 5-prime end of the human HD gene carrying 100–150 glutamine (CAG) repeats. Fig. 1E dnm1l-atad3-5 3589462 N/A 3589477 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589475 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fibroblasts from human patients Fig. 1F, Supp Fig. 1C atad3a-dnm1l-1 3589463 N/A 3589477 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589475 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Brain samples from human patients Fig. 1G Supp. 1E dnm1l-atad3a-3 3589464 N/A 3589474 unspecified role unspecified role bait bait purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3589475 unspecified role unspecified role prey prey purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 1H atad3a-1 3589465 N/A 3589474 unspecified role unspecified role neutral component neutral component purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9NVI7-2:p.Lys135Gln mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q9NVI7-2:p.Lys135Glu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q9NVI7-2:p.Lys135Arg mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false Q9NVI7-2:p.Lys135Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. Stoichiometry: 2.0 direct interaction direct interaction false false false Fig. 4C Beta-mercaptoethanol (CHEBI:41218) dnm1l-atad3a-4 3589466 N/A 3589474 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q9NVI7-2:p.Lys135Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9NVI7-2:p.Lys135Gln mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false Q9NVI7-2:p.Lys135Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 3589475 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 4E, Supp Fig. 1G dnm1l-atad3-7 3589467 N/A 3589470 competitor competitor competitor prey prey protein delivery protein delivery region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false tat peptide fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3589469 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589470 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Peptide inhibition observed in R6/2 mice which are transgenic for the 5-prime end of the human HD gene carrying 100–150 glutamine (CAG) repeats. Fig. 5D dnm1l-atad3a-1 3589468 N/A 3589477 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3589475 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Brain samples from human patients Supp. 1D