IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lelong-1994-1 Identification of the amino acids involved in the functional interaction between photosystem I and ferredoxin from Synechocystis sp. PCC 6803 by chemical cross-linking. in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Lelong C., Setif P., Lagoutte B., Bottin H. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Cross-linking of purified Ferredoxin and purified photosytem I. the reaction was catalyzed by N-ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC) in the presence of N-hydroxysulfosuccinimide (NHS). The resulting complexes were analyzed by SDS-PAGE. fig 1 J. Biol. Chem. (0021-9258) 1994 Only protein-protein interactions imex curation lelong-1994-2 Identification of the amino acids involved in the functional interaction between photosystem I and ferredoxin from Synechocystis sp. PCC 6803 by chemical cross-linking. in vitro In vitro crosslink cross-linking study crosslink edman degradation edman degradation Lelong C., Setif P., Lagoutte B., Bottin H. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Cross-linking of purified Ferredoxin and purified photosytem I. the reaction was catalyzed by N-ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC) in the presence of N-hydroxysulfosuccinimide (NHS). The resulting complexes were analyzed by SDS-PAGE. fig 1 J. Biol. Chem. (0021-9258) 1994 Only protein-protein interactions imex curation psad_syny3 Photosystem I reaction center subunit II Photosystem I 16 kDa polypeptide psaD slr0737 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MTELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLALGTQLRTKFKPKIQDYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV fer_syny3 Ferredoxin-1 Ferredoxin I petF fed ssl0020 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY petf-psad-2 Cross-linking of Ferredoxin with PsaD subunit of photosytem I (PSI) 332181 N/A 332183 unspecified role unspecified role neutral component neutral component syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) N/A 332184 unspecified role unspecified role neutral component neutral component syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) direct interaction direct interaction false false false Electron paramagnetic resonance measurements have shown that the cross-linked complex between ferredoxin and PSI was entirely photoreducible by photosytem I and that the molar ratio of ferredoxin to PSI was close to 1. petf-psad-3 Cross-linking of Ferredoxin with PsaD subunit of photosytem I (PSI) 332182 N/A 332183 unspecified role unspecified role neutral component neutral component lys106 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) N/A 332184 unspecified role unspecified role neutral component neutral component glu93 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) 332192 332190 direct interaction direct interaction false false false Electron paramagnetic resonance measurements have shown that the cross-linked complex between ferredoxin and PSI was entirely photoreducible by photosytem I and that the molar ratio of ferredoxin to PSI was close to 1. Chemical cross-linking permitted to demonstrate direct electrostatic attraction between FedI glutamate 93 and lysine 106 of PSI subunit PsaD.