matrixdb Institut de Biologie et de Chimie des Prot\u00c3\u00a9ines, 7, passage du Vercors 69 367 Lyon cedex 07 FRANCE matrixdb@ibcp.fr http://matrixdb.ibcp.fr Institut de Biologie et de Chimie des Prot\u00c3\u00a9ines, 7, passage du Vercors 69 367 Lyon cedex 07 FRANCE http://matrixdb.ibcp.fr marco-2020-1 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Marco Guerrin, David Fernig, Marcelo Lima, Mark Skidmore Coronavirus - Interactions investigated in the context of Coronavirus m.a.skidmore@keele.ac.uk bioRxiv 2020 imex curation This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. Only protein-protein interactions imex curation marco-2020-2 in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Marco Guerrin, David Fernig, Marcelo Lima, Mark Skidmore Coronavirus - Interactions investigated in the context of Coronavirus m.a.skidmore@keele.ac.uk bioRxiv 2020 imex curation This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. Only protein-protein interactions imex curation heparin Heparin small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) fgf2_human Fibroblast growth factor 2 Basic fibroblast growth factor FGF2 FGFB Heparin-binding growth factor 2 protein protein human Homo sapiens Human MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS fgf2-heparin-1 3680859 N/A 3680861 unspecified role unspecified role bait bait Tag Biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false pig-intestinal mucosa pig Pig intestinal mucosa N/A 3680862 unspecified role unspecified role prey prey purified purified Tag His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 1A This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. cov_2 spike s1 protein-heparin-1 3680859 N/A 3680861 unspecified role unspecified role bait bait Tag Biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false pig-intestinal mucosa pig Pig intestinal mucosa direct interaction direct interaction false false false Figure 1B This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. cov_2 spike s1 protein-heparin-2 3680860 N/A 3680861 unspecified role unspecified role neutral component neutral component pig-intestinal mucosa pig Pig intestinal mucosa direct interaction direct interaction false false false Figure 2 The 2019 coronavirus (SARS-CoV-2) surface protein (Spike) S1 Receptor Binding Domain undergoes conformational change upon heparin binding. This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review.