IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ li-2021-6 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Li X., Hou P., Ma W., Wang X., Wang H., Yu Z., Chang H., Wang T., Jin S., Wang X., Wang W., Zhao Y., Zhao Y., Xu C., Ma X., Gao Y., He H., Li X., Hou P., Ma W., Wang X., Wang H., Yu Z., Chang H., Wang T., Jin S., Wang X., Wang W., Zhao Y., Zhao Y., Xu C., Ma X., Gao Y., He H. Virus - Publications including interactions involving viral proteins There is no Uniprot reviewed entry for Orf10 as the existence of the protein is uncertain. The sequence of Orf10 used here - A0A663DJA2 - will become the Uniprot reviewed entry should the existence of the protein be confirmed. hongmeiwang@sdnu.edu.cn,yuwei0901@outlook.com,hongbinhe@sdnu.edu.cn Cellular & molecular immunology 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus The authors have stated that Flag-NIX was of Human origin. li-2021-5 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li X., Hou P., Ma W., Wang X., Wang H., Yu Z., Chang H., Wang T., Jin S., Wang X., Wang W., Zhao Y., Zhao Y., Xu C., Ma X., Gao Y., He H., Li X., Hou P., Ma W., Wang X., Wang H., Yu Z., Chang H., Wang T., Jin S., Wang X., Wang W., Zhao Y., Zhao Y., Xu C., Ma X., Gao Y., He H. Virus - Publications including interactions involving viral proteins There is no Uniprot reviewed entry for Orf10 as the existence of the protein is uncertain. The sequence of Orf10 used here - A0A663DJA2 - will become the Uniprot reviewed entry should the existence of the protein be confirmed. hongmeiwang@sdnu.edu.cn,yuwei0901@outlook.com,hongbinhe@sdnu.edu.cn Cellular & molecular immunology 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus The authors have stated that Flag-NIX was of Human origin. li-2021-7 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Li X., Hou P., Ma W., Wang X., Wang H., Yu Z., Chang H., Wang T., Jin S., Wang X., Wang W., Zhao Y., Zhao Y., Xu C., Ma X., Gao Y., He H., Li X., Hou P., Ma W., Wang X., Wang H., Yu Z., Chang H., Wang T., Jin S., Wang X., Wang W., Zhao Y., Zhao Y., Xu C., Ma X., Gao Y., He H. Virus - Publications including interactions involving viral proteins There is no Uniprot reviewed entry for Orf10 as the existence of the protein is uncertain. The sequence of Orf10 used here - A0A663DJA2 - will become the Uniprot reviewed entry should the existence of the protein be confirmed. hongmeiwang@sdnu.edu.cn,yuwei0901@outlook.com,hongbinhe@sdnu.edu.cn Cellular & molecular immunology 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus The authors have stated that Flag-NIX was of Human origin. li-2021-8 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Li X., Hou P., Ma W., Wang X., Wang H., Yu Z., Chang H., Wang T., Jin S., Wang X., Wang W., Zhao Y., Zhao Y., Xu C., Ma X., Gao Y., He H., Li X., Hou P., Ma W., Wang X., Wang H., Yu Z., Chang H., Wang T., Jin S., Wang X., Wang W., Zhao Y., Zhao Y., Xu C., Ma X., Gao Y., He H. Virus - Publications including interactions involving viral proteins There is no Uniprot reviewed entry for Orf10 as the existence of the protein is uncertain. The sequence of Orf10 used here - A0A663DJA2 - will become the Uniprot reviewed entry should the existence of the protein be confirmed. hongmeiwang@sdnu.edu.cn,yuwei0901@outlook.com,hongbinhe@sdnu.edu.cn Cellular & molecular immunology 2021 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus The authors have stated that Flag-NIX was of Human origin. bni3l_human BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like NIP3-like protein X BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A Adenovirus E1B19K-binding protein B5 BNIP3L BNIP3A BNIP3H NIX protein protein human Homo sapiens Human MSSHLVEPPPPLHNNNNNCEENEQSLPPPAGLNSSWVELPMNSSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMKKGGIFSAEFLKVFIPSLFLSHVLALGLGIYIGKRLSTPSASTY a0a663dja2_sars2 ORF10 orf10 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT mlp3b_human Microtubule-associated proteins 1A/1B light chain 3B MAP1LC3B MAP1ALC3 Microtubule-associated protein 1 light chain 3 beta MAP1A/MAP1B light chain 3 B MAP1 light chain 3-like protein 2 Autophagy-related protein LC3 B Autophagy-related ubiquitin-like modifier LC3 B protein protein human Homo sapiens Human MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV bnip3l-orf10-1 4113046 N/A 4113050 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4113051 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 4D map1lc3b-orf10-1 4113046 N/A 4113052 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4113051 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 4F orf10-bnip3l-1 4113047 N/A 4113051 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4113050 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 4C orf10-bnip3l-2 4113048 N/A 4113050 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 4113051 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 4E bnip3l-orf10-2 4113049 N/A 4113051 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 4113050 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false 4G