UniProt UniProt http://www.uniprot.org strub-2011-2 in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Only protein-protein interactions imex curation imex curation strub-2011-3 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip tag visualisation tag visualisation Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Only protein-protein interactions imex curation imex curation strub-2011-6 mouse-heart Mus musculus heart [Cardiac; Cardiac tissue] heart Heart [Cardiac; Cardiac tissue] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Only protein-protein interactions imex curation imex curation strub-2011-4 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Only protein-protein interactions imex curation imex curation strub-2011-1 in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom sequence tag sequence tag identification sequence tag Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Cell type taken from cited reference Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Only protein-protein interactions imex curation imex curation strub-2011-5 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Sphingolipids were quantified by liquid chromatography, electrospray ionization-tandem mass spectrometry (LC-ESI-MS/MS) Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Only protein-protein interactions imex curation imex curation strub-2011-7 mouse-heart Mus musculus heart [Cardiac; Cardiac tissue] heart Heart [Cardiac; Cardiac tissue] anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Only protein-protein interactions imex curation imex curation strub-2011-8 mouse-heart Mus musculus heart [Cardiac; Cardiac tissue] heart Heart [Cardiac; Cardiac tissue] bn-page blue native page bn-page sequence tag sequence tag identification sequence tag Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S., Strub GM., Paillard M., Liang J., Gomez L., Allegood JC., Hait NC., Maceyka M., Price MM., Chen Q., Simpson DC., Kordula T., Milstien S., Lesnefsky EJ., Spiegel S. Coronavirus - Interactions investigated in the context of Coronavirus Interactions involving the mitochondrial respiratory complex IV were not added as the components of this complex were not determined. sspiegel@vcu.edu FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2011 Only protein-protein interactions imex curation imex curation phb2_human Prohibitin-2 BAP REA PHB2 D-prohibitin B-cell receptor-associated protein BAP37 Repressor of estrogen receptor activity protein protein human Homo sapiens Human MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK sphingosine 1-phosphate (2S,3R,4E)-2-amino-3-hydroxyoctadec-4-en-1-yl dihydrogen phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) phb2_mouse Prohibitin-2 B-cell receptor-associated protein BAP37 Repressor of estrogen receptor activity Phb2 Bap Bcap37 Rea protein protein mouse Mus musculus Mouse MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK dihydrosphingosine-1-phosphate Dihydrosphingosine-1-phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) phb_mouse Prohibitin Phb B-cell receptor-associated protein 32 protein protein mouse Mus musculus Mouse MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ sphk2_mouse Sphingosine kinase 2 Sphk2 protein protein mouse Mus musculus Mouse MAPPPLLPVAASTPILHGEFGSYPANGPRFALTLTTQALHIQRLRPKPEARPRDGLVSLDEVSGCGTLQSRSPEDTAAYFCIYTYPRGRRGGRRRATRTFRADGATTYEENRAEAQRWATALTCLLRGVPLSGDQEITPELLPRKPRLLILVNPFGGRGLAWQRCMDHVVPMISEAGLSFNLIQTERQNHARELVQGLSLSEWEGIVTVSGDGLLYEVLNGLLDRPDWEDAVRMPIGVLPCGSGNALAGAVNHHGGFEQVVGVDLLLNCSLLLCRGGSHPLDLLSVTLASGSRCFSFLSVAWGFLSDVDIHSERFRALGSARFTLGAVLGLASLHTYRGRLSYLPATTEPALPIPGHSLPRAKSELVLAPAPAPAATHSPLHRSVSDLPLPLPQPALVSPGSPEPLPDLSLNGGGPELTGDWGGAGDAPLSPDPLLPSSPNALKTAQLSPIAEGPPEMPASSGFLPPTHSAPEASTWGPVDHLLPPLGSPLPQDWVTIEGEFVLMLGILPSHLCADLMAAPHARFDDGVVHLCWVRSGISRAALLRILLAMEHGNHFSLGCPHLGYAAARAFRLEPLTPRGLLTVDGELVEYGPIQAQVHPGLATLLTGPAGQKPQA cox41_mouse Cytochrome c oxidase subunit 4 isoform 1, mitochondrial Cox4i1 Cox4 Cox4a Cytochrome c oxidase subunit IV isoform 1 Cytochrome c oxidase polypeptide IV protein protein mouse Mus musculus Mouse MLASRALSLIGKRAISTSVCLRAHGSVVKSEDYAFPTYADRRDYPLPDVAHVTMLSASQKALKEKEKADWSSLSRDEKVQLYRIQFNESFAEMNRGTNEWKTVVGMAMFFIGFTALVLIWEKSYVYGPIPHTFDRDWVAMQTKRMLDMKANPIQGFSAKWDYDKNEWKK This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport mint cox1_mouse Cytochrome c oxidase subunit 1 Mtco1 COI mt-Co1 Cytochrome c oxidase polypeptide I protein protein mouse Mus musculus Mouse MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSILIRAELGQPGALLGDDQIYNVIVTAHAFVMIFFMVMPMMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGIISHVVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGLDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMLWALGFIFLFTVGGLTGIVLSNSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPLFSGFTLDDTWAKAHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTTWNTVSSMGSFISLTAVLIMIFMIWEAFASKREVMSVSYASTNLEWLHGCPPPYHTFEEPTYVKVK phb_human Prohibitin PHB PHB1 protein protein human Homo sapiens Human MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ cx7a1_mouse Cytochrome c oxidase subunit 7A1, mitochondrial Cox7a1 Cox7a Cox7ah Cytochrome c oxidase subunit VIIa-heart Cytochrome c oxidase subunit VIIa-muscle protein protein mouse Mus musculus Mouse MRALRVSQALVRSFSSSTRSHLENRVAEKQKLFQADNDLPVHLKGGGMDNVLYRLTMTLTLGGTAYCLYCLGWASFPHKK This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport mint cox6c_mouse Cytochrome c oxidase subunit 6C Cytochrome c oxidase polypeptide VIc Cox6c protein protein mouse Mus musculus Mouse MSSGALLPKPQMRGLLAKRLRVHIAGAFIVALGVAAAYKFGVAEPRKKAYAEFYRNYDSMKDFEEMRKAGIFQSAK cx6b1_mouse Cytochrome c oxidase subunit 6B1 Cox6b1 Cox6b Cytochrome c oxidase subunit VIb isoform 1 protein protein mouse Mus musculus Mouse MAEDIKTKIKNYKTAPFDSRFPNQNQTKNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPVSWVSAWDDRIAEGTFPGKI cox5b_mouse Cytochrome c oxidase subunit 5B, mitochondrial Cox5b Cytochrome c oxidase polypeptide Vb protein protein mouse Mus musculus Mouse MASRLLRGVGALAAQALRRTARGAAVTRSMASGGGVPTDEEQATGLEREIMIAAQKGLDPYNMLPPKAASGTKEDPNLVPSISNKRIVGCICEEDNCTVIWFWLHKGESQRCPNCGTHYKLVPHQMAH cox5a_mouse Cytochrome c oxidase subunit 5A, mitochondrial Cox5a Cytochrome c oxidase polypeptide Va protein protein mouse Mus musculus Mouse MLAAALRRCTAAAAARGLLHPASAPSPAAAVCSIRCYSHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV cox2_mouse Cytochrome c oxidase subunit 2 Cytochrome c oxidase polypeptide II Mtco2 COII mt-Co2 COX2 protein protein mouse Mus musculus Mouse MAYPFQLGLQDATSPIMEELMNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAVILIMIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENWSASMI sphingosine 1_phosphate-phb2-1 3709516 N/A 3709524 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells N/A 3709525 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 1D, E sphingosine 1_phosphate-phb2-2 3709516 N/A 3709525 competitor competitor competitor prey prey purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3709524 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells N/A 3709525 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 1E sphingosine 1_phosphate-phb2-5 3709516 N/A 3709524 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3709525 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 2G sphingosine 1_phosphate-phb2-6 3709516 N/A 3709525 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3709526 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false Fig. 4E sphingosine 1_phosphate-phb2-3 3709517 N/A 3709524 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells N/A 3709525 unspecified role unspecified role prey prey purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 1F phb2-sphingosine 1_phosphate-1 3709517 N/A 3709524 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3709525 unspecified role unspecified role prey prey purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 2A phb2-sphingosine 1_phosphate-2 3709517 N/A 3709525 competitor competitor competitor prey prey purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3709524 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3709525 unspecified role unspecified role prey prey purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 3709517 Fig. 2A, Supp Fig.1 phb2-dihydrosphingosine_1_phosphate-1 3709517 N/A 3709527 competitor competitor competitor prey prey purified purified chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3709524 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3709525 unspecified role unspecified role prey prey purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 3709517 Fig. 2A phb2-phb-2 3709518 N/A 3709526 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3709528 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 4C Interaction observed in sphk2-/-cells. phb2-phb-3 3709518 N/A 3709529 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3709526 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3709528 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Fig. 4C phb2-cox4i1-1 3709518 N/A 3709530 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3709531 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3709528 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3709526 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Supp. Fig. 3 Interaction observed in sphk2-/-cells but interaction with COX subuniits decreases phb-phb2-3 3709519 N/A 3709524 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3709532 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 2B phb2-phb-1 3709519 N/A 3709524 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3709532 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 2B,2F sphingosine 1_phosphate-1 3709520 N/A 3709524 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3709525 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 1A-C sphingosine 1_phosphate-phb2-4 3709521 N/A 3709524 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3709525 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2C,D phb2-sphingosine 1_phosphate-4 3709522 N/A 3709526 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3709525 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2C,D cox4i1-cox5a-4 3709523 N/A 3709533 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3709530 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3709534 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3709535 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3709536 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3709537 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3709538 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Supp. Table 2