DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ fan-2005-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Fan H., Ooi A., Tan YW., Wang S., Fang S., Liu DX., Lescar J. Coronavirus - Interactions investigated in the context of Coronavirus DIP original experiment: DIP-132878X Structure (London, England : 1993) 2005 IMEx The nucleocapsid protein of coronavirus infectious bronchitis virus: crystal structure of its N-terminal domain and multimerization properties. Fan H., Ooi A., Tan YW., Wang S., Fang S., Liu DX., Lescar J. Only protein-protein interactions imex curation fan-2005-3 in vitro In vitro crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Fan H., Ooi A., Tan YW., Wang S., Fang S., Liu DX., Lescar J. Coronavirus - Interactions investigated in the context of Coronavirus DIP original experiment: DIP-132879X Structure (London, England : 1993) 2005 IMEx The nucleocapsid protein of coronavirus infectious bronchitis virus: crystal structure of its N-terminal domain and multimerization properties. Fan H., Ooi A., Tan YW., Wang S., Fang S., Liu DX., Lescar J. Only protein-protein interactions imex curation fan-2005-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Fan H., Ooi A., Tan YW., Wang S., Fang S., Liu DX., Lescar J. Coronavirus - Interactions investigated in the context of Coronavirus DIP original experiment: DIP-132880X Structure (London, England : 1993) 2005 IMEx The nucleocapsid protein of coronavirus infectious bronchitis virus: crystal structure of its N-terminal domain and multimerization properties. Fan H., Ooi A., Tan YW., Wang S., Fang S., Liu DX., Lescar J. Only protein-protein interactions imex curation ncap_ibvb Nucleoprotein N Nucleocapsid protein 6 protein protein ibvb ibvb IBV MASGKAAGKTDAPAPVIKLGGPKPPKVGSSGNASWFQAIKAKKLNTPPPKFEGSGVPDNENIKPSQQHGYWRRQARFKPGKGGRKPVPDAWYFYYTGTGPAADLNWGDTQDGIVWVAAKGADTKSRSNQGTRDPDKFDQYPLRFSDGGPDGNFRWDFIPLNRGRSGRSTAASSAAASRAPSREGSRGRRSDSGDDLIARAAKIIQDQQKKGSRITKAKADEMAHRRYCKRTIPPNYRVDQVFGPRTKGKEGNFGDDKMNEEGIKDGRVTAMLNLVPSSHACLFGSRVTPKLQLDGLHLRFEFTTVVPCDDPQFDNYVKICDQCVDGVGTRPKDDEPKPKSRSSSRPATRGNSPAPRQQRPKKEKKLKKQDDEADKALTSDEERNNAQLEFYDEPKVINWGDAALGENEL 562F39C475DB8872 ibvn-1 3139899 N/A 3139902 unspecified role unspecified role unspecified role unspecified role N-terminal Region 29-160 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false C-terminal Region 218-329 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ibvn-2 3139900 N/A 3139902 unspecified role unspecified role unspecified role unspecified role N-terminal Region 29-160 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false C-terminal Region 218-329 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false ibvn-3 3139901 N/A 3139902 unspecified role unspecified role unspecified role unspecified role N-terminal Region 29-160 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false