IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhang-1997-1 Histone deacetylases and SAP18, a novel polypeptide, are components of a human Sin3 complex. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip polyclonal western polyclonal antibody western blot polyclonal western Zhang Y., Iratni R., Erdjument-Bromage H., Tempst P., Reinberg D. Chromatin - Epigenetic interactions resulting in chromatin modulation This experiment demonstrated that hdac1 interacts with rbbp4, rbbp7 and the sin3 complex in-vivo. Fig 1a no email Cell (0092-8674) 1997 zhang-1997-2 Histone deacetylases and SAP18, a novel polypeptide, are components of a human Sin3 complex. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang Y., Iratni R., Erdjument-Bromage H., Tempst P., Reinberg D. Chromatin - Epigenetic interactions resulting in chromatin modulation This experiment demonstrated that hdac1 interacts with rbbp4, rbbp7 and the sin3 complex in-vivo. Fig 1a no email Cell (0092-8674) 1997 zhang-1997-3 Histone deacetylases and SAP18, a novel polypeptide, are components of a human Sin3 complex. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang Y., Iratni R., Erdjument-Bromage H., Tempst P., Reinberg D. Chromatin - Epigenetic interactions resulting in chromatin modulation This experiment demonstrated that hdac1 interacts with rbbp4, rbbp7 and the sin3 complex in-vivo. Human-293T cells were transfected with plasmid encoding either an N-terminal FLAG epitope-tagged SAP18 or a C-terminal FLAG epitope-tagged HDAC1. Cells transfected with these plasmids, or with an empty FLAG vector plasmid were lysed, and antibodies against the FLAG tag were used to immunoprecipitate FLAG-SAP18, HDAC1-FLAG, and interacting polypeptides. Fig 1a no email Cell (0092-8674) 1997 hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA rbbp4_human Histone-binding protein RBBP4 Retinoblastoma-binding protein 4 Retinoblastoma-binding protein p48 Chromatin assembly factor 1 subunit C Chromatin assembly factor I p48 subunit Nucleosome-remodeling factor subunit RBAP48 RBBP4 RBAP48 protein protein human Homo sapiens Human MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS rbbp7_human Histone-binding protein RBBP7 RBBP7 RBAP46 Retinoblastoma-binding protein 7 Retinoblastoma-binding protein p46 Histone acetyltransferase type B subunit 2 Nucleosome-remodeling factor subunit RBAP46 protein protein human Homo sapiens Human MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSELEGQGS hdac2_human Histone deacetylase 2 HDAC2 protein protein human Homo sapiens Human MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP sap18_human Histone deacetylase complex subunit SAP18 18 kDa Sin3-associated polypeptide Sin3-associated polypeptide p18 Cell growth-inhibiting gene 38 protein 2HOR0202 SAP18 GIG38 protein protein human Homo sapiens Human MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGRMRPY hdac1-rbbp4-1 Co-ip of interaction between hdac1 and rbbp4 (RbAp48). 202043 N/A 202046 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged western blot western blot Immuno blot Immuno blot c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 202047 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Hdac1 and rbbp4 (RbAp48) interact in-vivo. hdac1-rbbp7-1 Co-ip of interaction between hdac1 and rbbp7 (RbAp46). 202043 N/A 202048 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 202046 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged western blot western blot Immuno blot Immuno blot c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Hdac1 and rbbp7 (RbAp46) interact in-vivo. hdac1-hdac1-1 Co-ip of interaction between hdac1 and hdac1. 202043 N/A 202046 unspecified role unspecified role prey prey N/A 202046 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged western blot western blot Immuno blot Immuno blot c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Hdac1 can interact with itself in-vivo. hdac1-hdac2-2 Co-ip of interaction between hdac1 and hdac2. 202043 N/A 202046 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged western blot western blot Immuno blot Immuno blot c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 202049 unspecified role unspecified role prey prey physical association physical association false false false Hdac1 can interact with hdac2 in-vivo. sap18-hdac1-1 GST pull-down showing interaction between sap18 and hdac1. 202044 N/A 202046 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 202050 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Demonstrates that sap18 interacts with hdac1. sap18-hdac1-2 Co-ip (in-vivo) showing interaction between sap18 and hdac1. 202045 N/A 202046 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 202050 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged polyclonal western polyclonal antibody western blot n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Demonstrates that sap18 interacts with hdac1 in-vivo.