IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kuras-1996-1 A heteromeric complex containing the centromere binding factor 1 and two basic leucine zipper factors, Met4 and Met28, mediates the transcription activation of yeast sulfur metabolism. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kuras L., Cherest H., Surdin-Kerjan Y., Thomas D. Chromatin - Epigenetic interactions resulting in chromatin modulation 8 EMBO J. (0261-4189) 1996 Only protein-protein interactions imex curation met4_yeast Transcriptional activator of sulfur metabolism MET4 MET4 YNL103W N2177 Methionine-requiring protein 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKQEQSHEGDSYSTEFINLFGKDTATHPSSNNGANNNGMGSTNSLDQFVATASSSSSLVTSSENRRPLIGDVTNRGNTNLYDHAVTPEILLEQLAYVDNFIPSLDNEFSNVDWNVNTTHNNANNNGADTFSSINANPFDLDEQLAIELSAFADDSFIFPDEDKPSNNNNNSNNGNDDHSNHDVLHEDPSTNNRQRNPHFLTQRRNTFLTSQYDQSKSRFSSKNKRNGNNGETNNFGDNMQNNHPFEPNFMGSPSQFPADATNMTSIDHGGFTNVDITSTENNTTGDNGVDALSNLLHRTTHTPNRSSPLSNVTSAQNSSSQQRKHSESKVDSNSDNNSSNKAPNITVPDYSIIPTSVLVTLLPRVNVPNGAYNSLISAGFDNDQIDAIAAIMAYHHQKKIRENNSNNNKNINTNDSQEAPILKNINELLSVLIPPSPAETRGPTTLSTSPSFNEHGVVAEASFLSSILELGIKHPKSNNIHNQRQPSRNDHKISRESDGNNGNDNVHHNNAVIKSSTTRGDEIAKIRSEPTLNASSSDHKENSLKRSHSGDLKNKKVPVDRKYSDNEDDEYDDADLHGFEKKQLIKKELGDDDEDLLIQSKKSHQKKKLKEKELESSIHELTEIAASLQKRIHTLETENKLLKNLVLSSGETEGIKKAESLKKQIFEKVQKE D65745E1FA40C09D met28_yeast Transcriptional activator of sulfur metabolism MET28 MET28 Methionine-requiring protein 28 YIR017C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAKQGWEKKSTNIDIASRKGMNVNNLSEHLQNLISSDSELGSRLLSLLLVSSGNAEELISMINNGQDVSQFKKLREPRKGKVAATTAVVVKEEEAPVSTSNELDKIKQERRRKNTEASQRFRIRKKQKNFENMNKLQNLNTQINKLRDRIEQLNKENEFWKAKLNDINEIKSLKLLNDIKRRNMGR cbf1_yeast Centromere-binding protein 1 CEP1 CP1 CPF1 J1730 YJR060W CBF1 Centromere-binding factor 1 Centromere promoter factor 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNSLANNNKLSTEDEEIHSARKRGYNEEQNYSEARKKQRDQGLLSQESNDGNIDSALLSEGATLKGTQSQYESGLTSNKDEKGSDDEDASVAEAAVAATVNYTDLIQGQEDSSDAHTSNQTNANGEHKDSLNGERAITPSNEGVKPNTSLEGMTSSPMESTQQSKNDMLIPLAEHDRGPEHQQDDEDNDDADIDLKKDISMQPGRRGRKPTTLATTDEWKKQRKDSHKEVERRRRENINTAINVLSDLLPVRESSKAAILACAAEYIQKLKETDEANIEKWTLQKLLSEQNASQLASANEKLQEELGNAYKEIEYMKRVLRKEGIEYEDMHTHKKQENERKSTRSDNPHEA met4-met28-1 Y2H showing that interaction between Met4 and Met28 occurs through their leucine zipper. 358843 N/A 358844 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 358845 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Interaction between Met4 and Met28 occurs via their leucine zipper regions met4-cbf1 Y2H showing interaction between Met4 and Cbf1. 358843 N/A 358846 unspecified role unspecified role prey prey ephfo Ephedra foeminea N/A 358844 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false The Met4 leucine zipper region is required for its' interaction with Cbf1.