IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bayne-2010-1 Stc1: a critical link between RNAi and chromatin modification required for heterochromatin integrity. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bayne EH., White SA., Kagansky A., Bijos DA., Sanchez-Pulido L., Hoe KL., Kim DU., Park HO., Ponting CP., Rappsilber J., Allshire RC. Chromatin - Epigenetic interactions resulting in chromatin modulation Wild type S. pombe cells were used. robin.allshire@ed.ac.uk Cell (0092-8674) 2010 Only protein-protein interactions imex curation bayne-2010-3 Stc1: a critical link between RNAi and chromatin modification required for heterochromatin integrity. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bayne EH., White SA., Kagansky A., Bijos DA., Sanchez-Pulido L., Hoe KL., Kim DU., Park HO., Ponting CP., Rappsilber J., Allshire RC. Chromatin - Epigenetic interactions resulting in chromatin modulation Wild type S. pombe cells were used. robin.allshire@ed.ac.uk Cell (0092-8674) 2010 Only protein-protein interactions imex curation bayne-2010-6 Stc1: a critical link between RNAi and chromatin modification required for heterochromatin integrity. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bayne EH., White SA., Kagansky A., Bijos DA., Sanchez-Pulido L., Hoe KL., Kim DU., Park HO., Ponting CP., Rappsilber J., Allshire RC. Chromatin - Epigenetic interactions resulting in chromatin modulation Wild type S. pombe cells were used. robin.allshire@ed.ac.uk Cell (0092-8674) 2010 Only protein-protein interactions imex curation bayne-2010-2 Stc1: a critical link between RNAi and chromatin modification required for heterochromatin integrity. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast pull down pull down sequence tag sequence tag identification sequence tag Bayne EH., White SA., Kagansky A., Bijos DA., Sanchez-Pulido L., Hoe KL., Kim DU., Park HO., Ponting CP., Rappsilber J., Allshire RC. Chromatin - Epigenetic interactions resulting in chromatin modulation Wild type S. pombe cells were used. robin.allshire@ed.ac.uk Cell (0092-8674) 2010 Only protein-protein interactions imex curation bayne-2010-4 Stc1: a critical link between RNAi and chromatin modification required for heterochromatin integrity. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Bayne EH., White SA., Kagansky A., Bijos DA., Sanchez-Pulido L., Hoe KL., Kim DU., Park HO., Ponting CP., Rappsilber J., Allshire RC. Chromatin - Epigenetic interactions resulting in chromatin modulation Wild type S. pombe cells were used. robin.allshire@ed.ac.uk Cell (0092-8674) 2010 Only protein-protein interactions imex curation bayne-2010-5 Stc1: a critical link between RNAi and chromatin modification required for heterochromatin integrity. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Bayne EH., White SA., Kagansky A., Bijos DA., Sanchez-Pulido L., Hoe KL., Kim DU., Park HO., Ponting CP., Rappsilber J., Allshire RC. Chromatin - Epigenetic interactions resulting in chromatin modulation Wild type S. pombe cells were used. robin.allshire@ed.ac.uk Cell (0092-8674) 2010 Only protein-protein interactions imex curation cen1:ura4_spomb_dna Outer repeat heterochromatin of centromere 1 dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ura4+ is a marker gene. cen-dg_spombe_dna S. pombe DNA from centromeric outer repeats dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast In S. pombe, a broad distribution of heterochromatin is observed at pericentromeric regions, subtelomeres and the silent mating-type locus. These loci share a common feature: each contains dg and/or dh repeats that serve as RNA interference (RNAi)-dependent heterochromatin nucleation centres. h3_yeast Histone H3 SIN2 YNL031C N2749 HHT1 YBR010W YBR0201 HHT2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS A6115FEB480AC67A yors_schpo Meiotic chromosome segregation protein P8B7.28c SPBP8B7.28c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MDFKSRKYKIKKHPKDCKLHAKKYRGTLNSKGKNDNDCLIMCMRCRKVKGIDSYSKTQWSKTFTFVRGRTVSVSDPKVICRTCQPKQHDSIWCTACQQTKGINEFSKAQRHVLDPRCQICVHSQRNDGDDNLESDKFVDPFIGDDSDLDDDIYIHDKQTINSEYADDVSDNTDEERTESKGQQESNSAEEYDDDDSDEDRMEEIFQQFKKEKQIV swi6_schpo Chromatin-associated protein swi6 swi6 SPAC664.01c SPAC824.10c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MKKGGVRSYRRSSTSKRSVIDDDSEPELPSMTKEAIASHKADSGSSDNEVESDHESKSSSKKLKENAKEEEGGEEEEEDEYVVEKVLKHRMARKGGGYEYLLKWEGYDDPSDNTWSSEADCSGCKQLIEAYWNEHGGRPEPSKRKRTARPKKPEAKEPSPKSRKTDEDKHDKDSNEKIEDVNEKTIKFADKSQEEFNENGPPSGQPNGHIESDNESKSPSQKESNESEDIQIAETPSNVTPKKKPSPEVPKLPDNRELTVKQVENYDSWEDLVSSIDTIERKDDGTLEIYLTWKNGAISHHPSTITNKKCPQKMLQFYESHLTFRENE F505CC8AC5E75EAB pur6_schpo_gene Ade6 S.pombe gene. gene gene yeast Saccharomyces cerevisiae Baker's yeast codes for the enzyme phosphoribosylaminoimidazole carboxylase involved in purine biosynthesis. Ensembl fungi accession no =SPCC1322.13. mat_spombe_dna Spombe mat - silent mating-type locus dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tlh_schpo_genes S. pombe telomere-associated tlh+genes (Telomere-Linked -Helicase) dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pyrf_schpo_gene Ura4-5' S. pombe gene gene gene schpm Schizosaccharomyces pombe (fission yeast) Fission yeast clr4_schpo Histone-lysine N-methyltransferase, H3 lysine-9 specific clr4 SPBC428.08c kmt1 Histone H3-K9 methyltransferase Cryptic loci regulator 4 Lysine N-methyltransferase 1 Protein lysine methyltransferase clr4 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSPKQEEYEVERIVDEKLDRNGAVKLYRIRWLNYSSRSDTWEPPENLSGCSAVLAEWKRRKRRLKGSNSDSDSPHHASNPHPNSRQKHQHQTSKSVPRSQRFSRELNVKKENKKVFSSQTTKRQSRKQSTALTTNDTSIILDDSLHTNSKKLGKTRNEVKEESQKRELVSNSIKEATSPKTSSILTKPRNPSKLDSYTHLSFYEKRELFRKKLREIEGPEVTLVNEVDDEPCPSLDFQFISQYRLTQGVIPPDPNFQSGCNCSSLGGCDLNNPSRCECLDDLDEPTHFAYDAQGRVRADTGAVIYECNSFCSCSMECPNRVVQRGRTLPLEIFKTKEKGWGVRSLRFAPAGTFITCYLGEVITSAEAAKRDKNYDDDGITYLFDLDMFDDASEYTVDAQNYGDVSRFFNHSCSPNIAIYSAVRNHGFRTIYDLAFFAIKDIQPLEELTFDYAGAKDFSPVQSQKSQQNRISKLRRQCKCGSANCRGWLFG 53C3EC87BCBA51FF rik1_schpo Chromatin modification-related protein rik1 rik1 SPCC11E10.08 Silencing protein rik1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MALCVHSFWATAVDTATSCHFISSENCLVLLQALKINIYLCSEVHGLQFFTSIPLFSTVKHIRPYRPPGLDRDYLFVVLNDDTYFSIYWDEDYQKVIVDHPPVRYRVTFPWNRNAKSYCLVDLRMRAIFLSIDEISMICIRILSAEERLKTGRSIDSGFPFSFPVHLIYDMCILNDSSTPTLVVLHSDGLDCYVTAFLLDLSSKSLGKGIRLFERVKPSMIMPFGKRGLLVFESLFIHCMYRGNFVTINGPCTTYMHWTPLKGQKMHYIVCDTNGYLFGVYSSILGKNKWSLVMERLPIPPFDFITSLNSIHEGLLFIGSKNSESKLINLSTLKDVDSIPNLGPIHDLLVLKNDIEKSFLVCAGTPRNASLIYFQHALKLDILGQTKISGILRAMVLPSYPEHKLFLGFPSETVAFNIKEDFQLELDPSLSTKERTIALSGTNGEFVQVTSTFLCIYDSAKRSRLVYIEKITNAACYQEYSAIVINGTALAIFKKDTEVARKVFESEISCLDFSAQFQIGVGFWSKQVMILTFSDNSSISCAFQTNVPSLPRNIILEGVGVDRNLLLVSSGSGEFKSYVLFKNNLVFSETKHFGTTPVSFRRFTMNIGTYIICNNDCPHMVYGFNGALCYMPLSMPQSYDVCQFRDNSGKDFLISVSLGGLKFLQLNPLPELTPRKVLLEHVPLQAIIFQNKLLLRTLENRYEDYESYKENYHLELVDSYDDNSFRVFSFTENERCEKVLKINESSLLVGTSIIEQDKLVPVNGRLILLEFEKELQSLKVVSSMVLSAAVIDLGVYNDRYIVAFGQQVAIVKLTEERLMIDSRISLGSIVLQLIVEGNEIAIADSIGRFTIMYFDGQKFIVVARYLFGENIVKAALYEGTVYIIATNSGLLKLLRYNKDAKNFNDRFICESVYHLHDKVSKFQNFPITNTNSFLEPKMLFATEIGAIGSIVSLKDKELELEELTRKIRKLKFSYLSSMDYESIEADLISPVPFIDGDLVIDVKRWASSELFRLCRSVEHRESLNSYQKVQALLEEIQSLC 0C76BB59E1215BF1 raf2_schpo Rik1-associated factor 2 SPCC970.07c Cryptic loci regulator 7 De-localization of swi6 protein 2 raf2 clr7 cmc2 dos2 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MPPVRAEKKRKTDLIEQVCVTNKAGELVDLEDVLEYGPYSLTGILSSEKDEQEPLFDESIVLGYSIKISPVWTYNLKDVPEKETMSIWIVTPQRRYGILSPSSEYKAIYEQISEKNRLFYLIKTKFKDDMISGTLEDYDNYIEVLKEKLELPSCFQAILLVQKHIRFLLTQMVATSSLHVWSESPFFIRIRSSYEHLILQINKNIYNARQERKKSKLSSNNPSDNNTTMKSSLNQALTLINLPEQPFSISSPTATPQLGVVKRTSPLRFPLNDIWLSGLRIVDPNIESISLWKRIQVSTSPKHQRYISLQEVCSVIAQQLQITNLEALNKLSSHGETLLQIMHTAFTWRGTKLFNDIKHAIGFRSSVQQARSQFRGYCYDYLFMHCNNGEKTSLHLLRTLICMKLDFSNAQLAAKILFHFLLFDIGSGLSGSDYTYEQYINHSAVAFSFTEEIFEKNFVTVLPDFVKLFSISFGYWPAFSFYDELLKLLRNKYPKVYSSTPNLCDQVWLDRTNLFPCNRSTRSTLPYRPTKLLDLASASSCLSKKETDFKQDTGLYSYNLEKVEALKVSPDLQTGIWSCPVQNCLYFAVCDNPYKPSQVIYDHLLGHVDSKFIFKTPSNSVRSFTNKLEHIMYNIN C3FF8306DD764CFB ago1_schpo Protein argonaute Eukaryotic translation initiation factor 2C 2-like protein ago1 PAZ Piwi domain protein ago1 Cell cycle control protein ago1 RNA interference pathway protein ago1 ago1 csp9 SPCC736.11 Protein slicer protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSYKPSSEIALRPGYGGLGKQITLKANFFQIISLPNETINQYHVIVGDGSRVPRKQSQLIWNSKEVKQYFGSSWMNSVYDGRSMCWSKGDIADGTIKVNIGSESHPREIEFSIQKSSKINLHTLSQFVNSKYSSDPQVLSSIMFLDLLLKKKPSETLFGFMHSFFTGENGVSLGGGVEAWKGFYQSIRPNQGFMSVNVDISSSAFWRNDSLLQILMEYTDCSNVRDLTRFDLKRLSRKFRFLKVTCQHRNNVGTDLANRVYSIEGFSSKSASDSFFVRRLNGEEQKISVAEYFLENHNVRLQYPNLPCILVKNGAMLPIEFCFVVKGQRYTAKLNSDQTANMIRFAVQRPFERVQQIDDFVHQMDWDTDPYLTQYGMKIQKKMLEVPARVLETPSIRYGGDCIERPVSGRWNLRGKRFLDPPRAPIRSWAVMCFTSTRRLPMRGIENFLQTYVQTLTSLGINFVMKKPPVLYADIRGSVEELCITLYKKAEQVGNAPPDYLFFILDKNSPEPYGSIKRVCNTMLGVPSQCAISKHILQSKPQYCANLGMKINVKVGGINCSLIPKSNPLGNVPTLILGGDVYHPGVGATGVSIASIVASVDLNGCKYTAVSRSQPRHQEVIEGMKDIVVYLLQGFRAMTKQQPQRIIYFRDGTSEGQFLSVINDELSQIKEACHSLSPKYNPKILVCTTQKRHHARFFIKNKSDGDRNGNPLPGTIIEKHVTHPYQYDFYLISHPSLQGVSVPVHYTVLHDEIQMPPDQFQTLCYNLCYVYARATSAVSLVPPVYYAHLVSNLARYQDVTADDTFVETSEASMDQEVKPLLALSSKLKTKMWYM F5CE397BF590D9E4 raf1_schpo Rik1-associated factor 1 SPCC613.12c Cryptic loci regulator 8 De-localization of swi6 protein 1 raf1 clr8 cmc1 dos1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MTNSSPRVKRRTDTQYLHSVSSKLPKVDFDTNNEEFFEEEFEIYDPFYRAELPCPKPSLSISKHSIAKVPSNVNKRLELQLLLTSGTFLPNSRPYLSERVRKHTHLLSNSITGDDKPSLIHVDFTPEECFILQEAKLKFGPVNSVQFNDAYSTHISPKLPGRAYEDCQKFEIDNPSLSPVDKHGAIILRTYKKNKKLLPDYLKSFYNAGSSYFQREQVHQLMDGESVFFLKPWKHFNETSGDTVCVAYNPLCEKFALGSTAQDGAYNRLGNLWIGDFHSETIQSLESHYKLNQVGEKEYSTISDLCFSKGNLFLYTGAFDNAVKVWDMEGNLCGIFNAPTDYIHKLALSDDDLLAVACKNGYGYLLSTDNSTGEILTSANLIYPEALEKGYSASLIEFSNFLGRSSDKVIIGYDSFHTSNNRGCLALFDASTASFVQKFNTADEAFTSLYMHPSQVGFVASSNTLSNGRVYYLDTRMYKVCLNFTTTQKDINHATISNSGILVTSSGTDNQTFVWDSRKPDKPLSLLKHGKTKMIHFDGANEEEVDAGINMAQWQPKGNLFVTGGSDGIVKVWDLRLNNPFIQNFTEMNSAITYGGFSEDASKLTVCCVGGDVNMYSLGNDNGNKFGEFRIIENRLLT 6CD360D8748AAF98 chp1_schpo Chromo domain-containing protein 1 chp1 SPAC18G6.02c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MVSVKPLPDIDSNEGETDADVYEVEDILADRVNKNGINEYYIKWAGYDWYDNTWEPEQNLFGAEKVLKKWKKRKKLIAKGLLEPFDAEDNEAKKMKREKEILRQQRQKRKSELTQLSQKVKEKFKKMRKKPARRIVTIANDEEEEDDQTMDEDAFERKSMQGELKERNLTDKTSTLSTSFGETSPDVNPFYLSEWPTVTDSILLSKSLSSDAIPLKNGEIKSTMLMPSDSDNSVPGIQNSNNLENTGAFVENANSPQSNTPLSTFRHSSPLSLSPVITSDNDVANSLFFSNSTPLPSSLKIKKEAPKLETHTILVSDNSGSLTKQDILSYFAFIKGNIEVFFLKSPKKDKVCNMAYIQFDSIEQAKLAYDKGHPSWHVTLVKGKISTDMEECKVSKSILKTTPSKKANARSVSFTQTTTDTLSESEKFASNVDLDENFDFNVNVTNEDAKQLKKSVIGSSWTTVNNDWNSVSKSDQTFENDGASKVVPAGNITLNSDNSLHHSISESEDLSSASTLSDYFRFVLRVGKSLYYAGELSFDISKLKAETEHQQLLRSLVSCKQVDVLRFVTSQYLEVFGTCLTKVLSGSLCIRSDVDMTHFKNILNRGNGAGIVLGSNYTLLLFTEDNNALMNLYDCQGQSNSPFWMVIFEPLESILVEWSAKNLRPKKPYHKSQSYLSYLLQLGHIDLHKIGAFQATQILIVSKQPSPEAEELEDTFREAAIPTFRGLEIPESLFLSQNVFVFLNVSLEDDFDQLQFLTLAKRKSCKFFLFGLSLPLKSPNDSHVGTDFKKNNEPLDKLTYSQYLRPMFPKGGVVSVTLSALIKTPRLLELISPFLEIKKDSWILILPPSIVDMVKSYFVTNNPDKSLLEIQNLLNTLQRYLTNPALKNVTLYQDWDIVIDDSADVSLASTLQLYQKKNYDKYRRFVLIHELKNELTPVNGLDIVDYDEFKETFMRAIGLK E92C16BBD0D5957C rdp1_schpo RNA-dependent RNA polymerase 1 rdp1 csp7 rdr1 SPAC6F12.09 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAVSLNDFISVKLKRYSRESPWERLRVPYRNKKQKKWASVHNNEAQLHSANKRNDNCLIQRSSTWRLGDMITLVIKDIPVTWLSNEGGKLYNLWEPLHDYGTIEFMKINEPLNGQTSTTAIVQFAPPPKVPFWEPNGKINVKGVDLAVQIDITAHRSHISRQVFSKNSFRSDQLVKIPLSSFKLGQVYDERIVPLFGVDCGITVTESNLLVYFNFKKLCVLFDASFDKQIETFRLDFDFHSIIGDVGTDYYDDHISLVFRFRFSPLIFRKSKNATESRVQTFWTASHLWRRHYDILPFNVSPTTASPIELLNCHNAPIGRCNVLVLSFSIRDESDKDDIAFLLHNLEKFNLKSQLDKVVFHLVPDYKHRCSLINDKEIEEEIAYLLQACLSKNLLSEIDLPIILANLKKLSKERAKKFLRLILTSKTALINPSELDFTKSFVFYDLSSASSIHIKKLYVTPTTLRIVEDSLEAGNRVIRNFKDFANRFMRVQITDEYYKQKIRGGSDGFRNEKLYSRIQQLLTYGIKVGNQIYEFLAFGNSQLREHGAYFFASGSDLNAKQIREWMGDFSEINSVSKYAARMGQCFSTTKEINRFCVDISLQDDIVRNNHCFTDGVGMASLSVIRRLSLEVKNHDMFPSAFQFRMGGYKGVLSLAPPTKLEYHQGNLVFPRRSQDKFKSFHSTLEVIKISRFSNAHLNMQLITLLEGLGVEKTVFLELTRSQLSKMNESINSKQKSILMLRDNVDEYHSTLIIADFIQAGFLERDDAFTENLLNLYYEWVLRLIKEKQKVSVPKGAYLLGVADETGTLKGHYDDAVLSVPEIFIQITDTSTSFGSYSTGKLKTRVIVGLCIVARNPSLHPGDVRVCKAVRCDELMHLKNVIVFPTTGDRSIPAMCSGGDLDGDEYTVIWDQRLLPKIVNYPPLLESSPKKSIDFLEGKPLIDSVKEFFVNYIKYDSLGLISNAWKAWAHDHDNNPEGIFGNVCLELAEMHSKAVDFAKSGVACKMQAKYHPKRYPDFMQKTKTRSFRSETAVGKIFRYAARFQRESGRPATYNPIMNTVYDPCMKLPRFKTEYLNVAEEVKKHYDNDLRSIMARFDISTEYEVYTAFILFKDDLAKTVNEYGLREEVSFQFDLLKKKYTQEYLEKCALSNQSAFDSSEYEERINSAVAATYDVTYDQRVKSVGNGTTEVLISFPYLFSSRLCQLSRKAMLTANNF 389B95C8217CB05C cen-dg_spombe_rna S. pombe RNA transcript from centromeric outer repeats rna ribonucleic acid RNA rna yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast In S. pombe, a broad distribution of heterochromatin is observed at pericentromeric regions, subtelomeres and the silent mating-type locus. These loci share a common feature: each contains dg and/or dh repeats that serve as RNA interference (RNAi)-dependent heterochromatin nucleation centres. ebp2_schpo Probable rRNA-processing protein ebp2 ebp2 SPAC17H9.05 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAGIESKQRRAQKKAAKAAMKEKKNKESNESSTSVEALNEKEMINTIKSPIIETADTADQENESEGSDEVELSDLEGIELEEDADLIRKRKLAINNTVALENIYERIKYPDDISFVENQAVTTKEPIIIENVEDDLARELAFYKQGVSSVKAAFAKLREANVLISRPHDYFAEMLKSDDHMEKVRQELIKEATAKKLSQQAKKQRELKKFGKQVQLAKQEERQREKKETLEKINLLKRKHTGGDLTTEDDFDIALSSASADTFKKGSRSTKSRPQPNPKRQKKNEKYGFGGPKHRSKSNDLDSLAATEFGRKGLKNIKSKKRPGKARREKARK serc_schpo Putative phosphoserine aminotransferase Phosphohydroxythreonine aminotransferase SPAC1F12.07 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSSREEVVNFAAGPAAMITSVVEEFGKDFVNFQGLGMGVAEISHRSKQGSGIVTSAESNFRKLYNIPENFHILFMQGGGTEQFAACLYNVYAHHALKNGNAKSLVANYIITGAWSKKAYAEAERLGFPCHVAVDMKELAGKYGSLPEDKDLKFTPDGETSLVYYCDNETVHGVEFNEPPTNIPKGAIRVCDVSSNFISRKIDFTKHDIIFAGAQKNAGPAGITVVFVRDSVLARPTPAELHKLNIPVSPTVSDYKIMADNHSLYNTLPVATLHAINLGLEYMLEHGGLVALEASSIEKSKLLYDTLDKHDLYISVVEPAARSRMNVTFRIEPQELESEFLAEAEKHHLVQLKGYRSVGGIRASLYNAISVEQTRRLIDLLESFAKAHSN nop58_schpo Nucleolar protein 58 nop58 SPAC23G3.06 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MFILTETAAGYAIFKAKDKLLKKRDALIEDLKSPEGASNLLKLQSFAKFESTVDALDNVSALVEGKVSSKLSSLLEGLSDSKSSTLVVADPKLGNAINKLPGLEFEIISDSSVQDLYRGIREHLSSLISGLAPSDLNAMSLGLSHSLSRHKLKFSPDKVDTMIVQAIALLDDLDKELNTYAMRVREWYGWHFPEMGKIIQDNLAYARVIKAMGMRTKCSETDFSDILPEEIEATLKSAAEISMGTEITEEDLDNIVMLADQVLELASYRAQLSEYLRNRMQAIAPNLTALVGELVGARLIAHAGSLMNLAKQPASTIQILGAEKALFRALKTKHSTPKYGLIYHASLVGQANSKNKGKIARVLATKAALSLRVDALSDKDTTNGNIGLENRIRVENRLRSLEGGKLLPLPTAPVQQSKVQINGTSAYSTATDAVTKDAEESQEDVEMDIVIEKKKKKSSKLKEADGESSKKEKKEKKDKKHKKSKRKSEESEDGESPKKKKKSKKSKD nop56_schpo Nucleolar protein 56 nop56 sik1 Ribosome biosynthesis protein sik1 SPBC646.10c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MADYLLYESATGYSLFDVVGADQIAAKTKEVQLSLQDISKFGKVVQLRSFIPFKNAAHALENANDISEGVLNDFLKNFLELNLPKASKKKKVSLGVQDKNLATSIKSEIDAIECDTSELTQDLLRGIRFHGDKLLKQLSPGDFERAQLGLGHSYSRAKVKFNVNRNDNMIIQAIAILDQLDKDINTFAMRMKEWYSWHFPELSKIVGDNYKYAVIVTLVGDKTTINDEMLHDLAAVVDDDKDIAQSIINAGKVSMGQDISEIDLENILSFAERVIKLSNYRKQLHNYLVQKMNVVAPNLAELIGEMVGARLISHAGSLTNLSKCPASTVQILGAEKALFRALKTRGNTPKYGIIYHSSFIGKAGAKNKGRISRFLANKCSIASRIDNFSDAPTTAFGQVLRRQVEERLNFFDTGVAPTRNSIAMAEAYEKALSSVNIDGDEEVDIDVEETVETISEKPSKKEKKDKKEKKKEKSKKKRSADDASEEVKKSKKKKKSH mas5_schpo Mitochondrial protein import protein mas5 mas5 SPBC1734.11 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MVKETKLYEVLNVDVTASQAELKKAYRKLALKYHPDKNPNAGDKFKEISRAYEILADEEKRATYDRFGEEGLQGGGADGGMSADDLFASFFGGGMFGGGMPRGPRKGKDLVHTIKVTLEDLYRGKTTKLALQKKVICPKCSGRGGKEGSVKSCASCNGSGVKFITRAMGPMIQRMQMTCPDCNGAGETIRDEDRCKECDGAKVISQRKILTVHVEKGMHNGQKIVFKEEGEQAPGIIPGDVIFVIDQKEHPRFKRSGDHLFYEAHVDLLTALAGGQIVVEHLDDRWLTIPIIPGECIRPNELKVLPGQGMLSQRHHQPGNLYIRFHVDFPEPNFATPEQLALLEKALPPRKIESAPKNAHTEECVLATVDPTEKVRIDNNVDPTTATSMDEDEDEEGGHPGVQCAQQ cul4_schpo Cullin-4 pcu4 cul4 SPAC3A11.08 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MPPEAKRIVVKGFDPRKSRQRQETYYVTMIDRLNMALQVVMAGLGLKTGYQELYSGVENLTRADQASRCFNILQHHMSSGIQLLKDSAESFIQLEGTETDTNACTVVVGCWNKWLERVEIVQNIFYYMDKTFLSHHPDYPTIEELSLSLFREKLMAVKNIQIPFLNSLLQSFENLHSSKSTDHAYLQDAMLMLHRTEMYSSVFVPMYLVMLSRFYDTESSQKIQELPLEEYLEYAMSSLEREDAYVEKFDIVRDKKSIRETVQRCLITSHLDTLTKGISQFIEKRDAHSCKLLYALLQFNHETEYLIQPWSDCLVDVGFKLVNDESKDDTLVQELLSFHKFLQVVVDESFLHDETLSYAMRKAFETFINGAKGSQREAPARLIAKYIDYLLRVGEQASGGKPLKEVFSEILDLFRYIASKDIFEAYYKLDIAKRLLLNKSASAQNELMLLDMLKKTCGSQFTHSLEGMFRDVNISKEFTSSFRHSKAAHNLHRDLYVNVLSQAYWPSYPESHIRLPDDMQQDLDCFEKFYLSKQVGKKISWYASLGHCIVKARFPLGNKELSISLFQACVLLQFNNCLGGEGISYQDLKKSTELSDIDLTRTLQSLSCARIRPLVMVPKSKKPSPDTMFYVNEKFTDKLYRVKINQIYLKEERQENSDVQEQVVRDRQFELQASIVRVMKQKEKMKHDDLVQYVINNVKDRGIPLVSDVKTAIEKLLEKEYLEREDNDIYTYVT ubl1_schpo Ubiquitin-like protein 1 ubl1 ned8 SPBC12D12.08c SPBC24C6.01c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MLIKVKTLTGKEIELDIDPNDKVSRIKERVEEKEGIPPSQQRLIYAGKQMADDKNAESYHLEGGSVLHLVLALRGGSC cenpa_schpo Histone H3-like centromeric protein cnp1 cnp1 sim2 SPBC1105.17 CENP-A homolog Silencing in the middle of the centromere protein 2 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAKKSLMAEPGDPIPRPRKKRYRPGTTALREIRKYQRSTDLLIQRLPFSRIVREISSEFVANFSTDVGLRWQSTALQCLQEAAEAFLVHLFEDTNLCAIHAKRVTIMQRDMQLARRIRGA h3-cen 908400 n/a 908406 unspecified role unspecified role prey prey n/a 908407 unspecified role unspecified role prey prey n/a 908408 unspecified role unspecified role bait bait lys9 (possible) n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false association association false false false Anti-H3K9me2 chromatin immunoprecipitation (ChIP) on stc1-delta cells indicates that, as in dcr1-delta cells, H3K9me2 is only partially reduced on centromeric outer repeats (cen-dg) but is completely lost from the cen1:ura4+ marker gene. Consistent with this, a reduced level of Swi6 remains associated with outer repeats, but not with cen1:ura4+. Fig 1E. h3-cen-1 908400 n/a 908408 unspecified role unspecified role bait bait lys9 (possible) n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false n/a 908407 unspecified role unspecified role prey prey n/a 908409 unspecified role unspecified role ancillary ancillary O94276:p.Lys100Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false O94276:p.Arg116Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false association association false false false Anti-H3K9me2 chromatin immunoprecipitation (ChIP) on stc1-delta cells indicates that, as in dcr1-delta cells, H3K9me2 is only partially reduced on centromeric outer repeats (cen-dg) but is completely lost from the cen1:ura4+ marker gene. Consistent with this, a reduced level of Swi6 remains associated with outer repeats, but not with cen1:ura4+. Fig 1E, 6D. Interaction reduced in dcr-/- and stc1-/- cells and not observed in clr4-/- cells. H3K9me2 levels associated with cen(dg) in wild type, stc1-K100A, and stc1-R116A containing mutants. The K100A and R116A mutations reduce binding as does deletion of stc1. swi6-cen-3 908400 n/a 908410 unspecified role unspecified role bait bait n/a 908406 unspecified role unspecified role prey prey n/a 908407 unspecified role unspecified role prey prey association association false false false Anti-H3K9me2 chromatin immunoprecipitation (ChIP) on stc1-delta cells indicates that, as in dcr1-delta cells, H3K9me2 is only partially reduced on centromeric outer repeats (cen-dg) but is completely lost from the cen1:ura4+ marker gene. Consistent with this, a reduced level of Swi6 remains associated with outer repeats, but not with cen1:ura4+. Fig 1E. swi6-cen-4 908400 n/a 908410 unspecified role unspecified role bait bait n/a 908407 unspecified role unspecified role prey prey association association false false false Anti-H3K9me2 chromatin immunoprecipitation (ChIP) on stc1-delta cells indicates that, as in dcr1-delta cells, H3K9me2 is only partially reduced on centromeric outer repeats (cen-dg) but is completely lost from the cen1:ura4+ marker gene. Consistent with this, a reduced level of Swi6 remains associated with outer repeats, but not with cen1:ura4+. Fig 1E. Interaction observed in STC-/- and DCR-/- cells. h3-gbd_ade 908400 n/a 908411 unspecified role unspecified role prey prey n/a 908408 unspecified role unspecified role bait bait lys9 (possible) n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false association association false false false Fig 2F, S5G, and 6F, 5F. Stc1 is required for establishment of GBD-Clr4-Delta-cd (3xgbs-ade6+) mediated silencing, and ChIP analyses confirmed that establishment of H3K9me on the reporter required Stc1, whereas maintenance of H3K9me was largely unaffected in stc1-Delta cells. Establishment of silencing by tethered Clr4 (3xgbs-ade6+), which requires Stc1, was unaffected by Stc1 LIM domain mutations (K100A and K116A). The mutation on image S5G "K116A" is not mentioned anywhere else in the paper and may refer to the mutation "R116A". Recruitment of Stc1K100A or Stc1R116A to ade6+ by fusion to TetRoff resulted in H3K9 methylation and silencing. Interaction observed in stc1-/-, dcr-/-, ago-/-, chp1-/- and rdp1-/- cells but not clr4-/-, rik1-/-, dos1-/- or dos2-/- cells. stc1-cendg-1 908400 n/a 908409 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 908407 unspecified role unspecified role prey prey association association false false false Stc1-FLAG associates with centromeric outer repeats, dependent on functional Dcr1 and Clr4. Fig 4B. Interaction is observed in clr3-/- cells but not in dcr-/- or clr4-/- cells. stc1-mat 908400 n/a 908409 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 908412 unspecified role unspecified role prey prey association association false false false Dcr1- and Clr4-dependent enrichment of Stc1-FLAG at telomeres and mat2-mat3 was also detected by ChIP. Fig S4A. Interaction observed in Dcr-/- cells. stc1-tlh 908400 n/a 908409 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 908413 unspecified role unspecified role prey prey association association false false false Dcr1- and Clr4-dependent enrichment of Stc1-FLAG at telomeres and mat2-mat3 was also detected by ChIP. Fig S4A. Interaction not observed in clr4-/- cells and reduced in dcr1-/- cells. stc1-4xtet-ade6 908400 n/a 908414 unspecified role unspecified role prey prey n/a 908409 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tetr_off fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Stc1 fused to a TetRoff DNA-binding domain plus two FLAG tags (TetRoff-Stc1) was expressed in cells with four tet operators upstream of an ade6+ reporter (4xTetO-ade6+). This resulted in recruitment of TetRoff-Stc1 to the reporter and silencing of the ade6+ gene. Fig 5B. h3k9me2-4tet-ade6 908400 n/a 908408 unspecified role unspecified role bait bait lys9 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false n/a 908411 unspecified role unspecified role prey prey association association false false false Tethered Stc1 (TetRoff-Stc1) induces H3K9 methylation over the reporter that is maintained in RNAi mutants but not in clr4-Delta, rik1-Delta, dos1-Delta, and dos2-Delta cells. (A 4xTetO-ade6+ reporter was used: 4xTetO repeats were introduced upstream of ade6+ inserted at the ura4+ locus). Fig 5F. stc1-clr4 908401 n/a 908415 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 908409 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figs 3B/C and S3B. Clr4, Rik1, and Dos2 associate with Stc1 even in the absence of RNAi. Association of Stc1-FLAG with the RITS component Ago1 (myc-Ago1) was also observed. Interaction observed in dcr-/- and ago1-/- cells but not in rik1-/-, raf1-/- or raf2-/- cells. stc1-rik1 908401 n/a 908416 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 908409 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figs 3B/C and S3C. Clr4, Rik1, and Dos2 associate with Stc1 even in the absence of RNAi. Association of Stc1-FLAG with the RITS component Ago1 (myc-Ago1) was also observed. Interaction observed in dcr-/-, clr4-/- and ago1-/- cells but not in raf1-/- or raf2-/- cells. stc1-raf2 908401 n/a 908417 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 908409 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figs 3B/C and S3C. Clr4, Rik1, and Dos2 associate with Stc1 even in the absence of RNAi. Association of Stc1-FLAG with the RITS component Ago1 (myc-Ago1) was also observed. Interaction was observed in dcr1-/-, clr4-/- and ago-/- cells but not in raf1-/- or rik1-/- cells. stc1-ago1 908401 n/a 908418 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 908409 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figs 3B/C and S3D. Clr4, Rik1, and Dos2 associate with Stc1 even in the absence of RNAi. Association of Stc1-FLAG with the RITS component Ago1 (myc-Ago1) was also observed. Interaction was not observed in clr4-/-, rik1-/-, raf1-/- and dcr1-/- cells. clr4-ago1 908401 n/a 908418 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 908415 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figs 3D. Clr4 association with Ago1 requires Stc1. Weak interaction not observed in stc1-/- or dcr1-/- cells. stc1-raf1 908401 n/a 908419 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 908409 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figs S3C. Clr4, Rik1, and Dos2 associate with Stc1 even in the absence of RNAi. Association of Stc1-FLAG with the RITS component Ago1 (myc-Ago1) was also observed. chp1-rdr1 908401 n/a 908420 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 908421 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figs S3F. The association of Rdp1 with Chp1 depends on Stc1 and Dcr1. rik1-raf1 908401 n/a 908416 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 908419 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig S3G. Interactions between CLRC components are unaffected by deletion of Stc1. Interaction observed in Stc1-/- cells. raf2-raf1 908401 n/a 908417 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 908419 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig S3G. Interactions between CLRC components are unaffected by deletion of Stc1. Interaction oberved in stc1-/- cells. stc1-rik1-4 908401 n/a 908416 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 908417 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 908409 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O94276:p.Arg116Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false n/a 908415 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 6E. IP-western analyses indicated that both Stc1K100A and Stc1R116A proteins still associate with Clr4, Rik1 and Dos2, indicating that LIM domain mutations do not affect Stc1-CLRC interactions. In contrast, we could not detect association of Stc1K100A or Stc1R116A proteins with Ago1. stc1-cendg-2 908402 n/a 908422 unspecified role unspecified role prey prey n/a 908409 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Centromeric outer repeat (dg) transcripts were enriched relative to act1+ gene transcripts in Rik1-FLAG IPs, Stc1-FLAG and FLAG-Ago1 IPs. The association of Stc1-FLAG with outer repeat transcripts was dependent on Dcr1 and Ago1. Stc1 IPs consistently showed greater enrichment for centromeric transcripts than IPs of other CLRC components. Fig 4D/E and S4B. Interaction not observed in dcr-/- or ago-/- cells. rik1-cendg-3 908402 n/a 908416 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 908422 unspecified role unspecified role prey prey physical association physical association false false false Centromeric outer repeat (dg) transcripts were enriched relative to act1+ gene transcripts in Rik1-FLAG IPs, Stc1-FLAG and FLAG-Ago1 IPs. The association of Stc1-FLAG with outer repeat transcripts was dependent on Dcr1 and Ago1. Fig 4D/E. ago1-cendg-4 908402 n/a 908422 unspecified role unspecified role prey prey n/a 908418 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Centromeric outer repeat (dg) transcripts were enriched relative to act1+ gene transcripts in Rik1-FLAG IPs, Stc1-FLAG and FLAG-Ago1 IPs. The association of Stc1-FLAG with outer repeat transcripts was dependent on Dcr1 and Ago1. Fig 4D/E. stc1-ubl1-1 908403 n/a 908423 unspecified role unspecified role prey prey n/a 908416 unspecified role unspecified role prey prey n/a 908417 unspecified role unspecified role prey prey n/a 908424 unspecified role unspecified role prey prey n/a 908425 unspecified role unspecified role prey prey n/a 908426 unspecified role unspecified role prey prey n/a 908427 unspecified role unspecified role prey prey n/a 908419 unspecified role unspecified role prey prey n/a 908428 unspecified role unspecified role prey prey n/a 908429 unspecified role unspecified role prey prey n/a 908409 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Proteins found specifically and reproducibly associated with Stc1-FLAG. Fig 3A. stc1-ago1-1 908404 n/a 908409 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false schpm Schizosaccharomyces pombe (fission yeast) Fission yeast n/a 908418 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig S3H. stc1-cenpa 908405 n/a 908430 unspecified role unspecified role neutral component neutral component n/a 908409 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Stc1-GFP and CENP-A/Cnp1 (centromere-specific H3 variant) costaining revealed one bright Stc1 focus in close proximity to the CENP-ACnp1 signal, suggesting that Stc1 primarily localizes at centromeres. Fig 4A. Colocalisation not observed in dcr-/- or clr4-/- cells.