IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kirik-2007-1 MIDGET unravels functions of the Arabidopsis topoisomerase VI complex in DNA endoreduplication, chromatin condensation, and transcriptional silencing. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kirik V., Schrader A., Uhrig JF., Hulskamp M. Chromatin - Epigenetic interactions resulting in chromatin modulation This study used plant protoplasts. vkirik@stanford.edu Plant Cell (1040-4651) 2007 kirik-2007-2 MIDGET unravels functions of the Arabidopsis topoisomerase VI complex in DNA endoreduplication, chromatin condensation, and transcriptional silencing. arath-leaf Arabidopsis thaliana leaf leaf leaf bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Kirik V., Schrader A., Uhrig JF., Hulskamp M. Chromatin - Epigenetic interactions resulting in chromatin modulation This study used plant protoplasts. vkirik@stanford.edu Plant Cell (1040-4651) 2007 rhl1_arath DNA-binding protein RHL1 RHL1 HYP7 At1g48380 Protein ROOT HAIRLESS 1 Protein ELONGATED HYPOCOTYL 7 F11A17.7 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVRASSSKKGGSKGGDKDDAESKQRKRLKTLALDNQLLSDSPAKSHSSLKPSKQVLKHHGTDIIRKSQRKNRFLFSFPGLLAPISAATIGDLDRLSTKNPVLYLNFPQGRMKLFGTILYPKNRYLTLQFSRGGKNVLCDDYFDNMIVFSESWWIGTKEENPEEARLDFPKELAQAENTEFDFQGGAGGAASVKKLASPEIGSQPTETDSPEVDNEDVLSEDGEFLDDKIQVTPPVQLTPPVQVTPVRQSQRNSGKKFNFAETSSEASSGESEGNTSDEDEKPLLEPESSTRSREESQDGNGITASASKLPEELPAKREKLKSKDSKLVQATLSNLFKKAEEKTAGTSKAKSSSKA top6a_arath DNA topoisomerase 6 subunit A TOP6A SPO11-3 BIN5 At5g02820 RHL2 Protein BRASSINOSTEROID INSENSITIVE 5 Protein ROOT HAIRLESS 2 Meiotic recombination protein SPO11-3 F9G14.130 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADKKKRKRSKDDEAEELPFKSILESDDVITELLKSYISSSIKAAAGAGGASSSSSKPLTLADLSLSSSCREVADLSLSSVQTEIETVIVQIARSILAGDGFSFSVPSRAASNQLYVPELDRIVLKDKSTLRPFASVSSVRKTTITTRILALIHQLCLRNIHVTKRDLFYTDVKLFQDQTQSDAVLDDVSCMLGCTRSSLNVIAAEKGVVVGRLIFSDNGDMIDCTKMGMGGKAIPPNIDRVGDMQSDAMFILLVEKDAAYMRLAEDRFYNRFPCIIVTAKGQPDVATRLFLRKMKMELKLPVLALVDSDPYGLKILSVYGCGSKNMSYDSANLTTPDIKWLGIRPSDLDKYKIPEQCRLPMTEQDIKTGKDMLEEDFVKKNPGWVEELNLMVKTKQKAEIQALSSFGFQYLSEVYLPLKLQQQDWL bin4_arath DNA-binding protein BIN4 At5g24630 BIN4 MID Protein BRASSINOSTEROID INSENSITIVE 4 Protein MIDGET K18P6.17 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSSREGSPDWLRSYEAPMTTSLLSLSSSDDDSPYRESEVISSLPLPDDDGDDIVVLETESVELLTRKNSETKVVTKQVSIEQVFSRKKKADASLNLEDSCAGKENGNNVDCEKLSSKHKDAQGGADSVWLVSSDSEPSSPIKQEVTVSTEKDADFVLEATEEEPAVKTVRKEKSPKTKSKSSRKTPKEGNSAQEILKTEDKDTDTTIAEQVTPEKSPKTKSKSSRKTPKEENCAQEILKTEDKDKDTDTDTIIAEEVTTDQKIKPSSGSSSRLPLVLSEKVNRTKVLVECEGDSIDLSGDMGAVGRVVVSDTTGDMYLDLKGTIYKSTIIPSRTFCVVNVGQTEAKIEAIMNDFIQLIPQSNVYEAETMVEGTLEGFTFESDDESNKNAKTAVKPADQSVGTEEETNTKAKPKAKAKGETVIGKKRGRPSKEKQPPAKKARNSAPKKPKAKK rhl1-rhl2 RHL1 interacts with RHL2 736225 N/A 736227 unspecified role unspecified role prey prey region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 736228 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 4G BAIT: At5g02820/F9G14_130 is RLH2 rhl1-midget-1 RHL1 interacts with At5g24630 (MIDGET) 736226 N/A 736227 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 736229 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false The authors do not state which tag (n-terminal YFP or c-terminal yfp) was fused to which protein. The use of the annotation 'tag' reflects this omission of information. Figure 4F The authors state that a " restored YFP fluorescence was localized in the nuclei of transfected protoplasts". Polyethylene glycol transformation of protoplasts.