IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yan-2007-1 Identification and characterization of two closely related histone H4 arginine 3 methyltransferases in Arabidopsis thaliana. in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as predetermined predetermined participant predetermined Yan D., Zhang Y., Niu L., Yuan Y., Cao X. Chromatin - Epigenetic interactions resulting in chromatin modulation It was not possible to ascertain the source organism of the histones or myelin basic protein used in the methyltransferase assay. The UniProt accession numbers for histone 4 protein and AtFib2 proteins were identified from sequence information provided in the materials and methods section of the report. xfcao@genetics.ac.cn Biochem. J. (0264-6021) 2007 Only protein-protein interactions imex curation yan-2007-2 Identification and characterization of two closely related histone H4 arginine 3 methyltransferases in Arabidopsis thaliana. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yan D., Zhang Y., Niu L., Yuan Y., Cao X. Chromatin - Epigenetic interactions resulting in chromatin modulation The UniProt accession numbers for histone 4 protein and AtFib2 proteins were identified from sequence information provided in the materials and methods section of the report. xfcao@genetics.ac.cn Biochem. J. (0264-6021) 2007 Only protein-protein interactions imex curation It was not possible to ascertain the source organism of the histones or myelin basic protein used in the methyltransferase assay. The UniProt accession numbers for histone 4 protein and AtFib2 proteins were identified from sequence information provided in the materials and methods section of the report. h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG anm12_arath Probable protein arginine N-methyltransferase 1.2 PRMT12 PRMT1.2 PRMT1A F6F22.30 At2g19670 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTSTENNNNGSDETQTTKLHFEDADESMHDGDDNNADVADDITSADYYFDSYSHFGIHEEMLKDVVRTKSYQDVIYKNKFLIKDKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADTAKEIVKSNGFSDVITVLKGKIEEIELPVPKVDVIISEWMGYFLLYENMLDTVLYARNKWLVDGGIVLPDKASLYVTAIEDAHYKDDKVEFWDDVYGFDMSCIKRRAITEPLVDTVDGNQIVTDSKLLKTMDISKMAAGDASFTAPFKLVAQRNDHIHALVAYFDVSFTMCHKKMGFSTGPKSRATHWKQTVLYLEDVLTICEGETITGSMTIAQNKKNPRDVDIKLSYSLNGQHCNISRTHFYKMR anm11_arath Protein arginine N-methyltransferase 1.1 PRMT11 PAM1 Arginine methyltransferase pam1 PRMT1.1 Histone-arginine N-methyltransferase PRMT11 PRMT1B T16L4.20 At4g29510 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTKNSNHDENEFISFEPNQNTKIRFEDADEDEVAEGSGVAGEETPQDESMFDAGESADTAEVTDDTTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQNKFLIKDKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADMAKEIVKANGFSDVITVLKGKIEEIELPTPKVDVIISEWMGYFLLFENMLDSVLYARDKWLVEGGVVLPDKASLHLTAIEDSEYKEDKIEFWNSVYGFDMSCIKKKAMMEPLVDTVDQNQIVTDSRLLKTMDISKMSSGDASFTAPFKLVAQRNDYIHALVAYFDVSFTMCHKLLGFSTGPKSRATHWKQTVLYLEDVLTICEGETITGTMSVSPNKKNPRDIDIKLSYSLNGQHCKISRTQHYKMR fbrl2_arath rRNA 2'-O-methyltransferase fibrillarin 2 FIB2 FLP Fibrillarin-like protein 2 Histone-glutamine methyltransferase MED36A MED36_1 L73G19.10 At4g25630 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRPPLTGSGGGFSGGRGRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRGGARGGRGPAGRGGMKGGSKVIVEPHRHAGVFIAKGKEDALVTKNLVPGEAVYNEKRISVQNEDGTKTEYRVWNPFRSKLAAAILGGVDNIWIKPGAKVLYLGAASGTTVSHVSDLVGPEGCVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILALNASYFLKSGGHFVISIKANCIDSTVPAEAVFQTEVKKLQQEQFKPAEQVTLEPFERDHACVVGGYRMPKKPKAATAA prmt1a-h4 AtPRM1a methylates Human Histone 4 661673 N/A 661675 enzyme target enzyme target substrate substrate unspecified role unspecified role n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P62805:p.Arg20Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false arg20 mearg methylated arginine MeArg certain certain sequence position certain certain certain sequence position certain false N/A 661676 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false methylation methylation reaction methylation false false false 2C 2D Methylation of arginine at amino acid position 20. prmt1b-h4 AtPRM1b methylates Human Histone 4 661673 N/A 661677 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 661675 enzyme target enzyme target substrate substrate unspecified role unspecified role n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P62805:p.Arg20Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false arg20 mearg methylated arginine MeArg certain certain sequence position certain certain certain sequence position certain false methylation methylation reaction methylation false false false 2C 2D Methylation of arginine at amino acid position 20. prmt1a-fib2 AtPRM1a methylates AtFib2 661673 N/A 661676 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 661678 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false methylation methylation reaction methylation false false false 6A 6B Methylation of AtFib2 The authors state "To determine the type of activity that AtPRMT1a and AtPRMT1b catalyze, GST-AtFib2N1-150 was subjected to Western blot after methyltransferase activity assay transferred onto nitrocellulose membrane and probed with antibody specific for asymmetrically dimethylated arginines. The result demonstrated the presence of asymmetric dimethylation on GST-AtFib2N1-150, suggesting AtPRMT1a and AtPRMT1b are type I arginine methyltransferase." prmt1b-fib2 AtPRM1b methylates AtFib2 661673 N/A 661678 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 661677 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false methylation methylation reaction methylation false false false 6A 6B Methylation of AtFib2 The authors state "To determine the type of activity that AtPRMT1a and AtPRMT1b catalyze, GST-AtFib2N1-150 was subjected to Western blot after methyltransferase activity assay transferred onto nitrocellulose membrane and probed with antibody specific for asymmetrically dimethylated arginines. The result demonstrated the presence of asymmetric dimethylation on GST-AtFib2N1-150, suggesting AtPRMT1a and AtPRMT1b are type I arginine methyltransferase." prm1a-prm1b AtPRM1a interacts with AtPRM1b 661674 N/A 661677 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 661677 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 5