IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ villa-2007-4 Role of the polycomb repressive complex 2 in acute promyelocytic leukemia. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Villa R., Pasini D., Gutierrez A., Morey L., Occhionorelli M., Vire E., Nomdedeu JF., Jenuwein T., Pelicci PG., Minucci S., Fuks F., Helin K., Di Croce L. Apoptosis - Interactions involving proteins with a function related to apoptosis This paper and the referenced paper Di Croce et al. (2002) state that the constructs PML-RAR alpha and p53 are of human origin and thus the PML and RAR alpha constructs are indicated to be also. The referenced paper states that the Suz12 construct is of human origin and this indicates that the EZH2 and EED constructs are also. luciano.dicroce@crg.es Cancer Cell (1535-6108) 2007 Only protein-protein interactions 17 imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer villa-2007-3 Role of the polycomb repressive complex 2 in acute promyelocytic leukemia. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Villa R., Pasini D., Gutierrez A., Morey L., Occhionorelli M., Vire E., Nomdedeu JF., Jenuwein T., Pelicci PG., Minucci S., Fuks F., Helin K., Di Croce L. Apoptosis - Interactions involving proteins with a function related to apoptosis This paper and the referenced paper Di Croce et al. (2002) state that the constructs PML-RAR alpha and p53 are of human origin and thus the PML and RAR alpha constructs are indicated to be also. The referenced paper states that the Suz12 construct is of human origin and this indicates that the EZH2 and EED constructs are also. luciano.dicroce@crg.es Cancer Cell (1535-6108) 2007 Only protein-protein interactions 17 imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer villa-2007-1 Role of the polycomb repressive complex 2 in acute promyelocytic leukemia. human-nb4 Human NB4 APL cell line nb4 NB4 human acute promyelocytic leukemia cells Human acute promyelocytic leukemia established from the bone marrow of a 23- year-old woman with acute promyelocytic leukemia (APL = AML FAB M3) in second relapse in 1989; patented cell line; cells carry the t(15;17) PML-RARA fusion gene confirmed as human with IEF of AST, MDH anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Villa R., Pasini D., Gutierrez A., Morey L., Occhionorelli M., Vire E., Nomdedeu JF., Jenuwein T., Pelicci PG., Minucci S., Fuks F., Helin K., Di Croce L. Apoptosis - Interactions involving proteins with a function related to apoptosis This paper and the referenced paper Di Croce et al. (2002) state that the constructs PML-RAR alpha and p53 are of human origin and thus the PML and RAR alpha constructs are indicated to be also. The referenced paper states that the Suz12 construct is of human origin and this indicates that the EZH2 and EED constructs are also. luciano.dicroce@crg.es Cancer Cell (1535-6108) 2007 Only protein-protein interactions 17 imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer villa-2007-2 Role of the polycomb repressive complex 2 in acute promyelocytic leukemia. human-u937_pr9 Homo sapiens U937-PR9 lymphoma cells expressing zinc-inducible PML-RAR alpha u937_pr9 U937-PR9 hematopoietic precursor cells expressing zinc-inducible PML-RAR alpha U937-PR9 cells, which are hematopoietic precursor cells carrying the PML-RARa coding sequence under the control of a zinc-inducible promoter. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Villa R., Pasini D., Gutierrez A., Morey L., Occhionorelli M., Vire E., Nomdedeu JF., Jenuwein T., Pelicci PG., Minucci S., Fuks F., Helin K., Di Croce L. Apoptosis - Interactions involving proteins with a function related to apoptosis U937-PR9 cells express PML-RAR alpha under the control of a zinc-inducible promoter. Cells were treated with zinc or untreated. This paper and the referenced paper Di Croce et al. (2002) state that the constructs PML-RAR alpha and p53 are of human origin and thus the PML and RAR alpha constructs are indicated to be also. The referenced paper states that the Suz12 construct is of human origin and this indicates that the EZH2 and EED constructs are also. luciano.dicroce@crg.es Cancer Cell (1535-6108) 2007 Only protein-protein interactions 17 imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer villa-2007-5 Role of the polycomb repressive complex 2 in acute promyelocytic leukemia. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Villa R., Pasini D., Gutierrez A., Morey L., Occhionorelli M., Vire E., Nomdedeu JF., Jenuwein T., Pelicci PG., Minucci S., Fuks F., Helin K., Di Croce L. Apoptosis - Interactions involving proteins with a function related to apoptosis This paper and the referenced paper Di Croce et al. (2002) state that the constructs PML-RAR alpha and p53 are of human origin and thus the PML and RAR alpha constructs are indicated to be also. The referenced paper states that the Suz12 construct is of human origin and this indicates that the EZH2 and EED constructs are also. luciano.dicroce@crg.es Cancer Cell (1535-6108) 2007 Only protein-protein interactions 17 imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer villa-2007-6 Role of the polycomb repressive complex 2 in acute promyelocytic leukemia. human-hl_60 Homo sapiens acute myeloid leukemia cell line hl_60 human acute myeloid leukemia cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Villa R., Pasini D., Gutierrez A., Morey L., Occhionorelli M., Vire E., Nomdedeu JF., Jenuwein T., Pelicci PG., Minucci S., Fuks F., Helin K., Di Croce L. Apoptosis - Interactions involving proteins with a function related to apoptosis This paper and the referenced paper Di Croce et al. (2002) state that the constructs PML-RAR alpha and p53 are of human origin and thus the PML and RAR alpha constructs are indicated to be also. The referenced paper states that the Suz12 construct is of human origin and this indicates that the EZH2 and EED constructs are also. luciano.dicroce@crg.es Cancer Cell (1535-6108) 2007 Only protein-protein interactions 17 imex curation Chromatin - Epigenetic interactions resulting in chromatin modulation Cancer - Interactions investigated in the context of cancer ezh2_human Histone-lysine N-methyltransferase EZH2 KMT6 Enhancer of zeste homolog 2 ENX-1 Lysine N-methyltransferase 6 EZH2 protein protein human Homo sapiens Human MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP rara_human Retinoic acid receptor alpha RARA NR1B1 Nuclear receptor subfamily 1 group B member 1 protein protein human Homo sapiens Human MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP q15156_human PML-RAR protein protein human Homo sapiens Human MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKAIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP tp53_rara_human_protein p53-RAR alpha fusion protein protein protein human Homo sapiens Human DGEYFTLQIRGRERFEMFRELNEALELKDAQAMASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP An amino acid sequence which is not represented in UniProt The p53 tetramerization domain is fused to RAR alpha to induce oligomerization of RAR alpha. pml_human Protein PML PML MYL RNF71 TRIM19 Tripartite motif-containing protein 19 RING finger protein 71 Promyelocytic leukemia protein PP8675 E3 SUMO-protein ligase PML RING-type E3 SUMO transferase PML protein protein human Homo sapiens Human MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPEEAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQS suz12_human Polycomb protein SUZ12 CHET9 JJAZ1 KIAA0160 SUZ12 Suppressor of zeste 12 protein homolog Joined to JAZF1 protein Chromatin precipitated E2F target 9 protein protein protein human Homo sapiens Human MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL eed_human Polycomb protein EED EED WD protein associating with integrin cytoplasmic tails 1 Embryonic ectoderm development protein protein protein human Homo sapiens Human MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR rara-ezh2 RAR alpha coimmunoprecipitates EZH2 from 293T lysates 651623 N/A 651629 unspecified role unspecified role prey prey N/A 651630 unspecified role unspecified role bait bait physical association physical association false false false 1 D P10276 transfection q15156-ezh2-1 PML-RAR alpha coimmunoprecipitates EZH2 from 293T lysates 651623 N/A 651629 unspecified role unspecified role prey prey N/A 651631 unspecified role unspecified role bait bait physical association physical association false false false 1 D, S1 C Q15156; Q15910 transfection PML-RAR alpha AHT (A529G, H530G, T533A) retains the capability to bind EZH2. tp53_rara-ezh2 p53-RAR alpha coimmunoprecipitates EZH2 from 293T lysates 651623 N/A 651629 unspecified role unspecified role prey prey N/A 651632 unspecified role unspecified role bait bait physical association physical association false false false 1 D P04637 transfection pml-ezh2 PML coimmunoprecipitates EZH2 and SUZ12 from 293T lysates 651623 N/A 651629 unspecified role unspecified role prey prey N/A 651633 unspecified role unspecified role bait bait N/A 651634 unspecified role unspecified role prey prey association association false false false 1 E P29590 transfection Cells were transfected with either EZH2 or SUZ12 expression vectors. suz12-q15156 PML-RAR alpha coimmunoprecipitates with SUZ12 in 293T lysates 651623 N/A 651631 unspecified role unspecified role prey prey N/A 651634 unspecified role unspecified role bait bait physical association physical association false false false S1 B Q15022; Q15156 transfection q15156-suz12-2 PML-RAR alpha coimmunoprecipitates SUZ12 in 293T lysates 651623 N/A 651634 unspecified role unspecified role prey prey N/A 651631 unspecified role unspecified role bait bait physical association physical association false false false S1 B Q15022; Q15156 transfection q15156-eed-1 Flag-PML-RAR alpha coimmunoprecipitates all PRC2 components 651624 n/a 651635 unspecified role unspecified role prey prey N/A 651629 unspecified role unspecified role prey prey N/A 651634 unspecified role unspecified role prey prey N/A 651631 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 1 C; S2 A Q15156; Q15022; Q15910; O75530 transfection ezh2-q15156-1 PML-RAR alpha coimmunoprecipitates with HA-EZH2 from 293T lysates 651624 N/A 651629 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 651631 unspecified role unspecified role prey prey physical association physical association false false false S1 A Q15156; Q15910 transfection q15156-ezh2-3 Flag-PML-RAR alpha coimmunoprecipitates EZH2 (1-612) 651624 N/A 651631 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 651629 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false S3 A, D Q15156; Q15910 transfection The presence of SUZ12 is required for the PML-RAR/EZH2 interaction. q15156-ezh2-4 Flag-PML-RAR alpha coimmunoprecipitates EZH2 and SUZ12 in 293T lysates 651624 N/A 651634 unspecified role unspecified role prey prey N/A 651629 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 651631 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false S3 B Q15156 transfection q15156-ezh2 PML-RAR alpha coimmunoprecipitates EZH2 in NB4 lysates 651625 N/A 651629 unspecified role unspecified role prey prey N/A 651631 unspecified role unspecified role bait bait physical association physical association false false false 1 A q15156-eed PML-RAR alpha coimmunoprecipitates EED in NB4 lysates 651625 n/a 651635 unspecified role unspecified role prey prey N/A 651631 unspecified role unspecified role bait bait physical association physical association false false false 1 A q15156-suz12 PML-RAR alpha coimmunoprecipitates SUZ12 in NB4 lysates 651625 N/A 651631 unspecified role unspecified role bait bait N/A 651634 unspecified role unspecified role prey prey physical association physical association false false false 1 A q15156-suz12-1 PML-RAR alpha coimmunoprecipitates SUZ12 from lysates of U937-PR9 cells treated with zinc 651626 N/A 651631 unspecified role unspecified role bait bait N/A 651634 unspecified role unspecified role prey prey physical association physical association false false false 1 B RAR alpha did not coimmunoprecipitate SUZ12 in cells not treated with zinc. ezh2-q15156 EZH2 coimmunoprecipitates PML-RAR alpha from lysates of U937-PR9 cells treated with zinc 651626 N/A 651631 unspecified role unspecified role prey prey N/A 651629 unspecified role unspecified role bait bait physical association physical association false false false 1 B EZH2 did not coimmunoprecipitate RAR alpha in cells not treated with zinc. q15156-ezh2-2 PML-RAR alpha coimmunoprecipitates HA-EZH2 from 293T lysates 651627 N/A 651631 unspecified role unspecified role bait bait N/A 651629 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S1 A Q15156; Q15910 transfection rara-ezh2-1 EZH2 coimmunoprecipitates with RAR alpha in HL60 lysates 651628 N/A 651629 unspecified role unspecified role prey prey N/A 651630 unspecified role unspecified role bait bait physical association physical association false false false S1 D