IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ song-2006-3 The transcriptional coactivator CAMTA2 stimulates cardiac growth by opposing class II histone deacetylases. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Song K., Backs J., McAnally J., Qi X., Gerard RD., Richardson JA., Hill JA., Bassel-Duby R., Olson EN. Chromatin - Epigenetic interactions resulting in chromatin modulation eric.olson@utsouthwestern.edu Cell (0092-8674) 2006 Only protein-protein interactions 3 imex curation song-2006-1 The transcriptional coactivator CAMTA2 stimulates cardiac growth by opposing class II histone deacetylases. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Song K., Backs J., McAnally J., Qi X., Gerard RD., Richardson JA., Hill JA., Bassel-Duby R., Olson EN. Chromatin - Epigenetic interactions resulting in chromatin modulation eric.olson@utsouthwestern.edu Cell (0092-8674) 2006 Only protein-protein interactions 3 imex curation song-2006-2 The transcriptional coactivator CAMTA2 stimulates cardiac growth by opposing class II histone deacetylases. rat-heart Rattus norvegicus heart heart Heart [Cardiac; Cardiac tissue] ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Song K., Backs J., McAnally J., Qi X., Gerard RD., Richardson JA., Hill JA., Bassel-Duby R., Olson EN. Chromatin - Epigenetic interactions resulting in chromatin modulation Primary neonatal cardiomyocytes were isolated form 1-3 day old rats. Eighteen to thirtysix hours after plating the cells were infected with adenovirus encoding FLAG-CAMTA2, ChIP was performed with anti-FLAG antibody. eric.olson@utsouthwestern.edu Cell (0092-8674) 2006 Only protein-protein interactions 3 imex curation song-2006-4 The transcriptional coactivator CAMTA2 stimulates cardiac growth by opposing class II histone deacetylases. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Song K., Backs J., McAnally J., Qi X., Gerard RD., Richardson JA., Hill JA., Bassel-Duby R., Olson EN. Chromatin - Epigenetic interactions resulting in chromatin modulation Ternary complex of biotinylated NKE oligo with GST Nke2-5 and CAMTA2 was pulled down using streptavidine beads. eric.olson@utsouthwestern.edu Cell (0092-8674) 2006 Only protein-protein interactions 3 imex curation anf_rat_gene Rat PND gene encoding atrial natriuretic factor gene gene rat Rattus norvegicus (Rat) Rat nkx25_mouse Homeobox protein Nkx-2.5 Nkx2-5 Csx Nkx-2.5 Nkx2e Homeobox protein NK-2 homolog E Cardiac-specific homeobox Homeobox protein CSX protein protein mouse Mus musculus Mouse MFPSPALTPTPFSVKDILNLEQQQRSLASGDLSARLEATLAPASCMLAAFKPEAYSGPEAAASGLAELRAEMGPAPSPPKCSPAFPAAPTFYPGAYGDPDPAKDPRADKKELCALQKAVELDKAETDGAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELLGPPPPPARRIAVPVLVRDGKPCLGDPAAYAPAYGVGLNAYGYNAYPYPSYGGAACSPGYSCAAYPAAPPAAQPPAASANSNFVNFGVGDLNTVQSPGMPQGNSGVSTLHGIRAW cmta2_human Calmodulin-binding transcription activator 2 CAMTA2 KIAA0909 protein protein human Homo sapiens Human MNTKDTTEVAENSHHLKIFLPKKLLECLPRCPLLPPERLRWNTNEEIASYLITFEKHDEWLSCAPKTRPQNGSIILYNRKKVKYRKDGYLWKKRKDGKTTREDHMKLKVQGMECLYGCYVHSSIVPTFHRRCYWLLQNPDIVLVHYLNVPALEDCGKGCSPIFCSISSDRREWLKWSREELLGQLKPMFHGIKWSCGNGTEEFSVEHLVQQILDTHPTKPAPRTHACLCSGGLGSGSLTHKCSSTKHRIISPKVEPRALTLTSIPHAHPPEPPPLIAPLPPELPKAHTSPSSSSSSSSSGFAEPLEIRPSPPTSRGGSSRGGTAILLLTGLEQRAGGLTPTRHLAPQADPRPSMSLAVVVGTEPSAPPAPPSPAFDPDRFLNSPQRGQTYGGGQGVSPDFPEAEAAHTPCSALEPAAALEPQAAARGPPPQSVAGGRRGNCFFIQDDDSGEELKGHGAAPPIPSPPPSPPPSPAPLEPSSRVGRGEALFGGPVGASELEPFSLSSFPDLMGELISDEAPSIPAPTPQLSPALSTITDFSPEWSYPEGGVKVLITGPWTEAAEHYSCVFDHIAVPASLVQPGVLRCYCPAHEVGLVSLQVAGREGPLSASVLFEYRARRFLSLPSTQLDWLSLDDNQFRMSILERLEQMEKRMAEIAAAGQVPCQGPDAPPVQDEGQGPGFEARVVVLVESMIPRSTWKGPERLAHGSPFRGMSLLHLAAAQGYARLIETLSQWRSVETGSLDLEQEVDPLNVDHFSCTPLMWACALGHLEAAVLLFRWNRQALSIPDSLGRLPLSVAHSRGHVRLARCLEELQRQEPSVEPPFALSPPSSSPDTGLSSVSSPSELSDGTFSVTSAYSSAPDGSPPPAPLPASEMTMEDMAPGQLSSGVPEAPLLLMDYEATNSKGPLSSLPALPPASDDGAAPEDADSPQAVDVIPVDMISLAKQIIEATPERIKREDFVGLPEAGASMRERTGAVGLSETMSWLASYLENVDHFPSSTPPSELPFERGRLAVPSAPSWAEFLSASTSGKMESDFALLTLSDHEQRELYEAARVIQTAFRKYKGRRLKEQQEVAAAVIQRCYRKYKQLTWIALKFALYKKMTQAAILIQSKFRSYYEQKRFQQSRRAAVLIQQHYRSYRRRPGPPHRTSATLPARNKGSFLTKKQDQAARKIMRFLRRCRHRMRELKQNQELEGLPQPGLAT nkx25_human Homeobox protein Nkx-2.5 NKX2-5 CSX NKX2.5 NKX2E Homeobox protein NK-2 homolog E Cardiac-specific homeobox Homeobox protein CSX protein protein human Homo sapiens Human MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW anf_rat-nkx2-5 370990 N/A 370994 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 370995 unspecified role unspecified role prey prey n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 370996 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro association association false false false 2B camta2-nkx2-6 370990 N/A 370995 unspecified role unspecified role bait bait n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 370996 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false 2B, 3C, 3D The protein described by the authors is 1196 AA long while the one in the UniProtKB entry is 1202 AA in length. Further the Swissprot sequence update did not include 31 aminoacids originally saved with the entry. camta2-nkx2-7 370990 N/A 370995 unspecified role unspecified role bait bait homeodomain gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind range range range range false ecoli Escherichia coli (strain K12) N/A 370996 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 3E, 3F anf_rat-camta2-1 ChIp 370991 N/A 370996 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 370994 unspecified role unspecified role prey prey nke region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false myc tagged 2-5 repeats present binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 2A Association with the promoter was enhanced when coexpressed with Nkx2-5 anf_rat-camta2 ChIp 370992 N/A 370996 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 370994 unspecified role unspecified role prey prey nke region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false association association false false false 2A nkx2_5-camta2 370993 N/A 370996 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 370997 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2C CAMTA2 localises to nucleus in the presence of Leptomycin B. Normally the protein localises to cytoplasm and nucleus. Deletion of the N terminal 206 aminoacids results in localisation to the nucleus and deletion of C terminal 80 aminoacids results in cytoplasmic localisation.