IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ downey-2006-1 A genome-wide screen identifies the evolutionarily conserved KEOPS complex as a telomere regulator. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom ms participant Identification by mass spectrometry ms participant Downey M., Houlsworth R., Maringele L., Rollie A., Brehme M., Galicia S., Guillard S., Partington M., Zubko MK., Krogan NJ., Emili A., Greenblatt JF., Harrington L., Lydall D., Durocher D. Chromatin - Epigenetic interactions resulting in chromatin modulation Interaction detected by LC MS MS 5A durocher@mshri.on.ca,d.a.lydall@ncl.ac.uk Cell (0092-8674) 2006 Only protein-protein interactions 10 imex curation downey-2006-2 A genome-wide screen identifies the evolutionarily conserved KEOPS complex as a telomere regulator. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom ms participant Identification by mass spectrometry ms participant Downey M., Houlsworth R., Maringele L., Rollie A., Brehme M., Galicia S., Guillard S., Partington M., Zubko MK., Krogan NJ., Emili A., Greenblatt JF., Harrington L., Lydall D., Durocher D. Chromatin - Epigenetic interactions resulting in chromatin modulation Interaction detected by LC MS MS 5A durocher@mshri.on.ca,d.a.lydall@ncl.ac.uk Cell (0092-8674) 2006 Only protein-protein interactions 10 imex curation downey-2006-3 A genome-wide screen identifies the evolutionarily conserved KEOPS complex as a telomere regulator. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Downey M., Houlsworth R., Maringele L., Rollie A., Brehme M., Galicia S., Guillard S., Partington M., Zubko MK., Krogan NJ., Emili A., Greenblatt JF., Harrington L., Lydall D., Durocher D. Chromatin - Epigenetic interactions resulting in chromatin modulation Interaction detected by LC MS MS 5A durocher@mshri.on.ca,d.a.lydall@ncl.ac.uk Cell (0092-8674) 2006 Only protein-protein interactions 10 imex curation downey-2006-4 A genome-wide screen identifies the evolutionarily conserved KEOPS complex as a telomere regulator. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Downey M., Houlsworth R., Maringele L., Rollie A., Brehme M., Galicia S., Guillard S., Partington M., Zubko MK., Krogan NJ., Emili A., Greenblatt JF., Harrington L., Lydall D., Durocher D. Chromatin - Epigenetic interactions resulting in chromatin modulation Interaction detected by LC MS MS 5A durocher@mshri.on.ca,d.a.lydall@ncl.ac.uk Cell (0092-8674) 2006 Only protein-protein interactions 10 imex curation kae1_yeast tRNA N6-adenosine threonylcarbamoyltransferase KAE1 t(6)A37 threonylcarbamoyladenosine biosynthesis protein KAE1 Kinase-associated endopeptidase 1 tRNA threonylcarbamoyladenosine biosynthesis protein KAE1 YKR038C N6-L-threonylcarbamoyladenine synthase protein protein yeast Saccharomyces cerevisiae Baker's yeast MVNLNTIPPKNGRDYYIALGLEGSANKLGVGIVKHPLLPKHANSDLSYDCEAEMLSNIRDTYVTPPGEGFLPRDTARHHRNWCIRLIKQALAEADIKSPTLDIDVICFTKGPGMGAPLHSVVIAARTCSLLWDVPLVGVNHCIGHIEMGREITKAQNPVVLYVSGGNTQVIAYSEKRYRIFGETLDIAIGNCLDRFARTLKIPNEPSPGYNIEQLAKKAPHKENLVELPYTVKGMDLSMSGILASIDLLAKDLFKGNKKNKILFDKTTGEQKVTVEDLCYSLQENLFAMLVEITERAMAHVNSNQVLIVGGVGCNVRLQEMMAQMCKDRANGQVHATDNRFCIDNGVMIAQAGLLEYRMGGIVKDFSETVVTQKFRTDEVYAAWRD 76A73F2E9E26CF4C bud32_yeast EKC/KEOPS complex subunit BUD32 YGR262C BUD32 LDB14 piD261 Low-dye-binding protein 14 Atypical serine/threonine protein kinase BUD32 Bud site selection protein 32 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTQEFIDKVSSYLTPDVDIAPISQGAEAIVFTTTTHPYLPRAKDSHQKYIIKYRPPKRYRHPQIDQALTKHRTLNESRLLAKLYLIPGLCVPQLIACDPYNGFIWLEFLGEDLPGGHGFSNLKNFLWMHDQDPYSDLVATTLRKVGRQIGLLHWNDYCHGDLTSSNIVLVRDGARWTPHLIDFGLGSVSNLVEDKGVDLYVLERAILSTHSKHAEKYNAWIMEGFEEVYREQGAKGAKKLKEVTKRFEEVRLRGRKRSMLG D12E97BAE21B3385 glrx3_yeast Monothiol glutaredoxin-3 YD8557.05C GRX3 YDR098C protein protein yeast Saccharomyces cerevisiae Baker's yeast MPVIEINDQEQFTYLTTTAAGDKLIVLYFHTSWAEPCKALKQVFEAISNEPSNSNVSFLSIDADENSEISELFEISAVPYFIIIHKGTILKELSGADPKEYVSLLEDCKNSVNSGSSQTHTMENANVNEGSHNDEDDDDEEEEEETEEQINARLTKLVNAAPVMLFMKGSPSEPKCGFSRQLVGILREHQVRFGFFDILRDESVRQNLKKFSEWPTFPQLYINGEFQGGLDIIKESLEEDPDFLQHALQS 8CC1A04EC1E7DAB3 gon7_yeast EKC/KEOPS complex subunit GON7 Low-dye-binding protein 6 Polarized growth chromatin-associated controller 2 YJL184W J0420 GON7 LDB6 PCC2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKLPVAQYSAPDGVEKSFAPIRDDPRYMTTEGRTTGPSDHVLNAGQIDRDKPSEPERTKDGSQLTYLGQLRTQLTGLQDDINEFLTGRMELAKNKKKAGADEKRIQEEINQLLDGGDGDEDAV glrx4_yeast Monothiol glutaredoxin-4 GRX4 SYGP-ORF64 YER174C protein protein yeast Saccharomyces cerevisiae Baker's yeast MTVVEIKSQDQFTQLTTTNAANKLIVLYFKAQWADPCKTMSQVLEAVSEKVRQEDVRFLSIDADEHPEISDLFEIAAVPYFVFIQNGTIVKEISAADPKEFVKSLEILSNASASLANNAKGPKSTSDEESSGSSDDEEDETEEEINARLVKLVQAAPVMLFMKGSPSEPKCGFSRQLVGILREHQIRFGFFDILRDENVRQSLKKFSDWPTFPQLYINGEFQGGLDIIKESIEEDPEYFQHALQ 86B4C4993545B5B2 cg121_yeast EKC/KEOPS complex subunit CGI121 CGI121 CGI-121 homolog YML036W protein protein yeast Saccharomyces cerevisiae Baker's yeast MVVSIIPQFPDIKVSLALFEQVKNAKEIRSKMSELSTSFAFIDPRLVCSGEQMYSAIYKTLIEVKYNKMRTRNLNSECVLCLSPTSNISDAFLKFGIKDDSSQLICLKFHTNTDDVDKEQLRTIMTSIVKGQEIEFNDDNLSRFYDEALIRKIYKLSDDFKPQDVNGLSRALVDAIQLRGV B0B697F8AB578ED4 bud32-kae1 Interaction detected by LC MS/MS 361501 N/A 361505 unspecified role unspecified role prey prey N/A 361506 unspecified role unspecified role prey prey N/A 361507 unspecified role unspecified role prey prey N/A 361508 unspecified role unspecified role prey prey N/A 361509 unspecified role unspecified role prey prey N/A 361510 unspecified role unspecified role prey prey N/A 361506 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false gon7-kae1 Interaction detected by LC MS/MS 361501 N/A 361508 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 361510 unspecified role unspecified role prey prey N/A 361505 unspecified role unspecified role prey prey N/A 361508 unspecified role unspecified role prey prey association association false false false kae1-bud32-1 Interaction detected by LC MS/MS 361501 N/A 361505 unspecified role unspecified role prey prey N/A 361508 unspecified role unspecified role prey prey N/A 361505 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 361510 unspecified role unspecified role prey prey association association false false false bud32-kae1-1 Interaction detected by Maldi-TOF MS 361502 N/A 361506 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 361506 unspecified role unspecified role prey prey N/A 361505 unspecified role unspecified role prey prey N/A 361510 unspecified role unspecified role prey prey association association false false false kae1-bud32 Interaction detected by Maldi-TOF MS 361502 N/A 361505 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 361506 unspecified role unspecified role prey prey N/A 361510 unspecified role unspecified role prey prey N/A 361505 unspecified role unspecified role prey prey association association false false false gon7-kae1-1 Interaction detected by Maldi-TOF MS 361502 N/A 361506 unspecified role unspecified role prey prey N/A 361508 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 361510 unspecified role unspecified role prey prey N/A 361505 unspecified role unspecified role prey prey association association false false false gon7-bud32 361503 N/A 361508 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 361506 unspecified role unspecified role prey prey physical association physical association false false false kae1-bud32-2 361503 N/A 361506 unspecified role unspecified role prey prey N/A 361505 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false cgi121-bud32 361503 N/A 361510 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 361506 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false bud32-kae1-2 361504 N/A 361506 unspecified role unspecified role neutral component neutral component N/A 361505 unspecified role unspecified role neutral component neutral component region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false The size of the complex purified is between 231 and 790 kDa.