IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ song-2006a-1 AtSAP18, an orthologue of human SAP18, is involved in the regulation of salt stress and mediates transcriptional repression in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Song CP., Galbraith DW. Chromatin - Epigenetic interactions resulting in chromatin modulation Directed yeast two hybrid galbraith@arizona.edu Plant Mol. Biol. (0167-4412) 2006 Only protein-protein interactions imex curation song-2006a-2 AtSAP18, an orthologue of human SAP18, is involved in the regulation of salt stress and mediates transcriptional repression in Arabidopsis. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Song CP., Galbraith DW. Chromatin - Epigenetic interactions resulting in chromatin modulation Directed yeast two hybrid galbraith@arizona.edu Plant Mol. Biol. (0167-4412) 2006 Only protein-protein interactions imex curation song-2006a-3 AtSAP18, an orthologue of human SAP18, is involved in the regulation of salt stress and mediates transcriptional repression in Arabidopsis. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa predetermined predetermined participant predetermined Song CP., Galbraith DW. Chromatin - Epigenetic interactions resulting in chromatin modulation Directed yeast two hybrid galbraith@arizona.edu Plant Mol. Biol. (0167-4412) 2006 Only protein-protein interactions imex curation hda19_arath Histone deacetylase 19 HDA19 At4g38130 F20D10.250 HD1 HDA1 RPD3A protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTGGNSLASGPDGVKRKVCYFYDPEVGNYYYGQGHPMKPHRIRMTHALLAHYGLLQHMQVLKPFPARDRDLCRFHADDYVSFLRSITPETQQDQIRQLKRFNVGEDCPVFDGLYSFCQTYAGGSVGGSVKLNHGLCDIAINWAGGLHHAKKCEASGFCYVNDIVLAILELLKQHERVLYVDIDIHHGDGVEEAFYATDRVMTVSFHKFGDYFPGTGHIQDIGYGSGKYYSLNVPLDDGIDDESYHLLFKPIMGKVMEIFRPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVKFMRSFNVPLLLLGGGGYTIRNVARCWCYETGVALGVEVEDKMPEHEYYEYFGPDYTLHVAPSNMENKNSRQMLEEIRNDLLHNLSKLQHAPSVPFQERPPDTETPEVDEDQEDGDKRWDPDSDMDVDDDRKPIPSRVKREAVEPDTKDKDGLKGIMERGKGCEVEVDESGSTKVTGVNPVGVEEASVKMEEEGTNKGGAEQAFPPKT sap18_arath Histone deacetylase complex subunit SAP18 At2g45640 F17K2.17 18 kDa Sin3-associated polypeptide protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAEAARRQGGGRPLPPPPRGVNQQPPRPKPEPVDREKTCPLLLRVFTKSGGHHTSEDYAVRGKEPKDEVQIYTWKDASLRELTDLVKEVSVAARRRNARLSFAFVYPNNKGGYNVREVGETMAYPNRKQPDDSKTLSELPFEIGDYLDVAIY erf82_arath Ethylene-responsive transcription factor 3 At1g50640 F17J6.16 F11F12.4 ERF3 ERF-3 Ethylene-responsive element-binding factor 3 ERF082 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRRGRGSSAVAGPTVVAAINGSVKEIRFRGVRKRPWGRFAAEIRDPWKKARVWLGTFDSAEEAARAYDSAARNLRGPKAKTNFPIDSSSPPPPNLRFNQIRNQNQNQVDPFMDHRLFTDHQQQFPIVNRPTSSSMSSTVESFSGPRPTTMKPATTKRYPRTPPVVPEDCHSDCDSSSSVIDDDDDIASSSRRRNPPFQFDLNFPPLDCVDLFNGADDLHCTDLRL erf78_arath Ethylene-responsive transcription factor 4 ERF4 ERF-4 ERF078 At3g15210 K7L4.1 Ethylene-responsive element-binding factor 4 Protein RELATED TO APETALA2 5 RAP2-5 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKMGLKPDPATTNQTHNNAKEIRYRGVRKRPWGRYAAEIRDPGKKTRVWLGTFDTAEEAARAYDTAARDFRGAKAKTNFPTFLELSDQKVPTGFARSPSQSSTLDCASPPTLVVPSATAGNVPPQLELSLGGGGGGSCYQIPMSRPVYFLDLMGIGNVGRGQPPPVTSAFRSPVVHVATKMACGAQSDSDSSSVVDFEGGMEKRSQLLDLDLNLPPPSEQA sap18-hda19 Directed Yeast 2 hybrid analysis reveals interaction between the SAP18 protein and HDA19 protein 493871 N/A 493874 unspecified role unspecified role prey prey N/A 493875 unspecified role unspecified role bait bait physical association physical association false false false Figure 3A sap18-erf3 Directed Yeast 2 hybrid analysis reveals interaction between the SAP18 protein and ERF3 protein 493871 N/A 493875 unspecified role unspecified role bait bait N/A 493876 unspecified role unspecified role prey prey physical association physical association false false false Figure 4A sap18-erf4 Directed Yeast 2 hybrid analysis reveals interaction between the SAP18 protein and ERF4 protein 493871 N/A 493875 unspecified role unspecified role bait bait N/A 493877 unspecified role unspecified role prey prey physical association physical association false false false Figure 4B sap18-hda19-1 Pulldown analysis reveals interaction between the SAP18 protein and HDA19 protein 493872 N/A 493875 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 493874 unspecified role unspecified role prey prey region n6btnlys N6-biotinyl-L-lysine (2S)-2-amino-6-(5-[(3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanoylamino)hexanoic acid (3aS-(3aalpha,4beta,6aalpha))-N6-(5-(hexahydro-2-oxo-1H-thieno(3,4-d)imidazol-4-yl)-1-oxopentyl)-L-lysine MOD_RES N6-biotinyllysine N6-[5-((3aS,4S,6aR)-hexahydro-2-oxo-1H-thieno[3,4-d]imidazol-4-yl)-1-oxopentyl]-L-lysine N6-biotinyl-L-lysine N6-biotinyllysine biocytin epsilon-N-biotinyllysine Biotin Biotinylation N6BtnLys biotinyl lysyl undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 3B sap18-erf4-1 Pulldown analysis reveals interaction between the SAP18 protein and ERF4 protein 493872 N/A 493877 unspecified role unspecified role prey prey region n6btnlys N6-biotinyl-L-lysine (2S)-2-amino-6-(5-[(3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanoylamino)hexanoic acid (3aS-(3aalpha,4beta,6aalpha))-N6-(5-(hexahydro-2-oxo-1H-thieno(3,4-d)imidazol-4-yl)-1-oxopentyl)-L-lysine MOD_RES N6-biotinyllysine N6-[5-((3aS,4S,6aR)-hexahydro-2-oxo-1H-thieno[3,4-d]imidazol-4-yl)-1-oxopentyl]-L-lysine N6-biotinyl-L-lysine N6-biotinyllysine biocytin epsilon-N-biotinyllysine Biotin Biotinylation N6BtnLys biotinyl lysyl undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 493875 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false Figure 4C sap18-erf3-1 Pulldown analysis reveals interaction between the SAP18 protein and ERF3 protein 493872 N/A 493876 unspecified role unspecified role prey prey N/A 493875 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false Figure 4C sap18-erf3-2 Electrophoretic mobility shift assay indicates binding between atSap18, ERF3 and HDA19 proteins 493873 N/A 493874 unspecified role unspecified role neutral component neutral component N/A 493876 unspecified role unspecified role neutral component neutral component N/A 493875 unspecified role unspecified role neutral component neutral component association association false false false Figure 5 C ERF3 O80339 protein was bound to a 16 base pair GCC box DNA oligonucleotide. sap18-erf3-3 Electrophoretic mobility shift assay indicates binding between atSap18, ERF3 and HDA19 proteins 493873 N/A 493876 unspecified role unspecified role neutral component neutral component N/A 493875 unspecified role unspecified role neutral component neutral component physical association physical association false false false Figure 5 B ERF3 O80339 protein was bound to a 16 base pair GCC box DNA oligonucleotide.