IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ xiao-2005-1 Specificity and mechanism of the histone methyltransferase Pr-Set7. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Xiao B., Jing C., Kelly G., Walker PA., Muskett FW., Frenkiel TA., Martin SR., Sarma K., Reinberg D., Gamblin SJ., Wilson JR. Chromatin - Epigenetic interactions resulting in chromatin modulation sgambli@nimr.mrc.ac.uk Genes Dev. (0890-9369) 2005 xiao-2005-2 Specificity and mechanism of the histone methyltransferase Pr-Set7. in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as ms participant Identification by mass spectrometry ms participant Xiao B., Jing C., Kelly G., Walker PA., Muskett FW., Frenkiel TA., Martin SR., Sarma K., Reinberg D., Gamblin SJ., Wilson JR. Chromatin - Epigenetic interactions resulting in chromatin modulation sgambli@nimr.mrc.ac.uk Genes Dev. (0890-9369) 2005 xiao-2005-3 Specificity and mechanism of the histone methyltransferase Pr-Set7. in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as predetermined predetermined participant predetermined Xiao B., Jing C., Kelly G., Walker PA., Muskett FW., Frenkiel TA., Martin SR., Sarma K., Reinberg D., Gamblin SJ., Wilson JR. Chromatin - Epigenetic interactions resulting in chromatin modulation Rates are derived from the incorporation of 3H CH3 after 10 min as measured by liquid scintillation counting of peptide separated from free AdoMet by reverse phase chromatography. sgambli@nimr.mrc.ac.uk Genes Dev. (0890-9369) 2005 xiao-2005-4 Specificity and mechanism of the histone methyltransferase Pr-Set7. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Xiao B., Jing C., Kelly G., Walker PA., Muskett FW., Frenkiel TA., Martin SR., Sarma K., Reinberg D., Gamblin SJ., Wilson JR. Chromatin - Epigenetic interactions resulting in chromatin modulation sgambli@nimr.mrc.ac.uk Genes Dev. (0890-9369) 2005 h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG kmt5a_human N-lysine methyltransferase KMT5A KMT5A H4-K20-HMTase KMT5A Histone-lysine N-methyltransferase KMT5A Lysine N-methyltransferase 5A Lysine-specific methylase 5A PR/SET domain-containing protein 07 PRSET7 SET domain-containing protein 8 SET07 SET8 SETD8 protein protein human Homo sapiens Human MGEGGAAAALVAAAAAAAAAAAAVVAGQRRRRLGRRARCHGPGRAAGGKMSKPCAVEAAAAAVAATAPGPEMVERRGPGRPRTDGENVFTGQSKIYSYMSPNKCSGMRFPLQEENSVTHHEVKCQGKPLAGIYRKREEKRNAGNAVRSAMKSEEQKIKDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH set8-h4 653275 N/A 653279 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false lys21 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 653280 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false working 18.7%, free 20.6% 1.50 A Table 1 The H4 peptide had a tyrosine residue at teh C terminal end. set8-h4-1 653276 N/A 653280 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 653279 enzyme target enzyme target substrate substrate unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 2B The H4 peptide had a tyrosine residue at the C terminal end. The H4 peptide was mono methylated. set8-h4-2 653277 N/A 653280 enzyme enzyme unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 653279 enzyme target enzyme target substrate substrate unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P62805:p.His19Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P62805:p.His19Gln mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P62805:p.His19Tyr mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 4 The H4 peptide had a tyrosine residue at the C terminal end. The H4 peptide was methylated. set8-h4-3 653278 N/A 653279 unspecified role unspecified role neutral component neutral component P62805:p.His19Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 653280 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 4 The H4 peptide had a tyrosine residue at the C terminal end.