UniProt UniProt http://www.uniprot.org mikami-2005-3 The functional region of CENP-H interacts with the Nuf2 complex that localizes to centromere during mitosis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mikami Y., Hori T., Kimura H., Fukagawa T. Chromatin - Epigenetic interactions resulting in chromatin modulation tfukagaw@lab.nig.ac.jp Mol. Cell. Biol. (0270-7306) 2005 mikami-2005-5 The functional region of CENP-H interacts with the Nuf2 complex that localizes to centromere during mitosis. chick-dt40 Gallus gallus bursa lymphoma dt40 chicken bursa lymphoma http://www.lgcpromochem-atcc.com/common/catalog/numSearch/numResults.cfm ATCC Number:CRL-2111 chicken bursa lymphoma anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mikami Y., Hori T., Kimura H., Fukagawa T. Chromatin - Epigenetic interactions resulting in chromatin modulation tfukagaw@lab.nig.ac.jp Mol. Cell. Biol. (0270-7306) 2005 mikami-2005-1 The functional region of CENP-H interacts with the Nuf2 complex that localizes to centromere during mitosis. chick-dt40 Gallus gallus bursa lymphoma dt40 chicken bursa lymphoma http://www.lgcpromochem-atcc.com/common/catalog/numSearch/numResults.cfm ATCC Number:CRL-2111 chicken bursa lymphoma fluorescence imaging fluorescence microscopy fluorescence imaging polyclonal immunost polyclonal antibody immunostaining polyclonal immunost Mikami Y., Hori T., Kimura H., Fukagawa T. Chromatin - Epigenetic interactions resulting in chromatin modulation tfukagaw@lab.nig.ac.jp Mol. Cell. Biol. (0270-7306) 2005 mikami-2005-2 The functional region of CENP-H interacts with the Nuf2 complex that localizes to centromere during mitosis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mikami Y., Hori T., Kimura H., Fukagawa T. Chromatin - Epigenetic interactions resulting in chromatin modulation tfukagaw@lab.nig.ac.jp HeLa cDNA library. Mol. Cell. Biol. (0270-7306) 2005 mikami-2005-4 The functional region of CENP-H interacts with the Nuf2 complex that localizes to centromere during mitosis. chick-dt40 Gallus gallus bursa lymphoma dt40 chicken bursa lymphoma http://www.lgcpromochem-atcc.com/common/catalog/numSearch/numResults.cfm ATCC Number:CRL-2111 chicken bursa lymphoma anti tag coip anti tag coimmunoprecipitation anti tag coip polyclonal western polyclonal antibody western blot polyclonal western Mikami Y., Hori T., Kimura H., Fukagawa T. Chromatin - Epigenetic interactions resulting in chromatin modulation tfukagaw@lab.nig.ac.jp Mol. Cell. Biol. (0270-7306) 2005 cenph_human Centromere protein H Interphase centromere complex protein 35 ICEN35 CENPH protein protein human Homo sapiens Human MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM ndc80_human Kinetochore protein NDC80 homolog Kinetochore protein Hec1 Kinetochore-associated protein 2 Highly expressed in cancer protein Retinoblastoma-associated protein HEC NDC80 HEC KNTC2 HEC1 protein protein human Homo sapiens Human MKRSSVSSGGAGRLSMQELRSQDVNKQGLYTPQTKEKPTFGKLSINKPTSERKVSLFGKRTSGHGSRNSQLGIFSSSEKIKDPRPLNDKAFIQQCIRQLCEFLTENGYAHNVSMKSLQAPSVKDFLKIFTFLYGFLCPSYELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWPHIVAALVWLIDCIKIHTAMKESSPLFDDGQPWGEETEDGIMHNKLFLDYTIKCYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLKASLQGDVQKYQAYMSNLESHSAILDQKLNGLNEEIARVELECETIKQENTRLQNIIDNQKYSVADIERINHERNELQQTINKLTKDLEAEQQKLWNEELKYARGKEAIETQLAEYHKLARKLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRAQVYVPLKELLNETEEEINKALNKKMGLEDTLEQLNAMITESKRSVRTLKEEVQKLDDLYQQKIKEAEEEDEKCASELESLEKHKHLLESTVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE ndc80_chick Kinetochore protein NDC80 homolog KNTC2 Kinetochore protein Hec1 Kinetochore-associated protein 2 NDC80 HEC1 RCJMB04_4o15 protein protein chick Gallus gallus (Chicken) Chicken MRRSSTTSGSSGRQSTMVLRVQDSNKMGLQTPQTKDRGTFGKLSMSKTTSATSERKVSFFGKRASGAGGSRNSQYGMFGTEKIKDPRPLHDKAFIQQCIKQLCEFLVENGYAHNVTIKSLQSPSVKDFIKIFTFIYGFLCPSYELPDSKFEEEIPRVFKELGYPFPLSKSSMYTVGAPHTWPQIVAALIWLTDCFKLYAAMRENPSSFDDGQNWGGETDDGIVHNKLFMDYVVKCYEHFMKGGDTYEELDAEVQSKLKDLFNVDEFKIEGLAAENKRLHEEIARLEKERESEPDRLVSLRKLRSSFQADVQKYQAYLANLESHTTILDQKMKSVNEEVETTEMEVEAMKQENARLQHIFDNQKYSVADIERINHERNELQQTINKLTKELEAEEHQLWNEELKYARNKEAIETQLAEYHKLARKLKLIPISAENSKGHDFEIHFNPEAGPNCLVKYRTQIKAPLMEIVNQTEEEIRKATQRKMSLEDTLEQVNAMVAEKKSSVKTLKEEAEKLDDLYHQKLKEAEEEEQKCANELELLEKHKQLLESGVNEGLSEATNELHDIQRQYQIVMQTTTEESRKAGDNLNRLLEVITTHVVSIEKYLDEQNSKIDRDYEEFMSEDLLSTLTGILDSYKKKAESI cenph_chick Centromere protein H CENPH protein protein chick Gallus gallus (Chicken) Chicken MAGRLSESVGSGPGAEAETAADPDAKRDVLEHLCARTHLKQLVMEFDTACPPDEGCNSGAEVNFIESAKETLEEVGKVKSAFESKALVIKRIQLMDALRKRVKENDGCARLIVETMRDIIKLNWEIIQAHQQARVIRENLNDIRRKRYFLKQAEGEKALRIFTTVRKKKEVVRMKIAEKLKFIHRNVQYERKVTTLVQNILQNIIVGCQINWAKDPSLRAIILQLEKDISIQNLL a0a1l1rlv7_chick HORMA domain-containing protein MAD2L1 protein protein chick Gallus gallus (Chicken) Chicken MAAQLSREQQGITLRGSAEIVAEFFSYGINSILYQRGIYPPETFTRVQKYGLTLLVTTDPELKNYLNNVVEQMKEWLYKCTVQRLVVVISSIENNEVLERWQFDIECDKNARGESAPREKSQKAIQDEIRSVIRQITATVTFLPLLETACAFDLLIYTDKDLVVPEKWEESGPQFIANSEEVRLRSFTTTIHKVNSMVAYKKDSFP spc24_chick protein protein chick Gallus gallus (Chicken) Chicken An amino acid sequence which is not represented in UniProt spc25_chick protein protein chick Gallus gallus (Chicken) Chicken An amino acid sequence which is not represented in UniProt o57392_chick centoromere protein C CENP-C protein protein chick Gallus gallus (Chicken) Chicken MAERLDHLKKYYRARFCGQGGKKINIQPGQNVLKYIQDCFECDDTDVTINSPNATSSSTPLVRNQERTSTQSPRPDAGLTIVVGNRTCHSTVSLPATPAETVRSKGEPCVFCPEPGRNSRIADSIKTDSPVHRGETQVLTFKDVEGLCESPAKLSDPEDDPGVVGSPLLVEEAKTPVQTRTVSIAPSSPSPVKDHNVEIESDCEFLIDESGCLSFKSWFSIPRKNRKSQKDGSAAPVLKSQSSDKEKTADKKGKNMNVQAEVHSEQKTKNVRVQRDLKRTSESHPVSSDSEGKVLKSKMQSSTHAGKSKKDALKGSSKHRKKMSYESEAEQLMLSGLDSETSDGEQKIRRVMPREDLAVPSAEHQQEQMLSSKKNLTPCKYQQSASKAYQRSVHKKQTKQTLANDTVLKSQRKKLKKSGKRNGNKNPEPRRWKSSDSEPGEEGLEREPLESNEMFTSPPHQELQTSVLQKLAKSEKAEKVLHALESVTDVNNKTPLKAVELLQHLVDSMKNSEKKRSSVTSSGKMLKKVHHRAHKRACSITRDSEPQNTTDSDSSSAPEVARKKRRQSAVRASKKPKSNRHQRLQHSPAAEKAMGPESGLVLEHSEKYTSPSKHCEENNESSDNSEDLHCQIKNLLSDEIGRQKIVLPSNTPNVRRTKRIRLKPLEYWRGERVTYTLKPSGRLLISGIAGAEAEPHMKNKLKSRHKKKRAKTRSEVVKCLDIPLADASKPTSIVDPVTNQEVLLECINSGSSHSCFFEDESIKVYKSLNTSDFAAGKLILKPLKEKGHQFVHMDTIAFYVIRGQIITTLHKTSYYLTSGDYFYVPAGNGYNIRNLLNEESVLHFTQLKNDRAPVGAELCSVTNENWSLEGKS nuf2_chick Kinetochore protein Nuf2 Cell division cycle-associated protein 1 NUF2 CDCA1 RCJMB04_29i8 protein protein chick Gallus gallus (Chicken) Chicken MEALTFPRYSPDDIVAYLRSHVLVGAEARNLTKADLFATLKPEVLHMIFIRILQKVYGIRLEHFYMMPVNVDIVYPQIFEGFLPVCNLYIHMERFLPVCRVNDFQMSDVINPKAKRTARFLSGILNFVHFRECRREAYLELQLNYKSAMEKHQQLETANQELEMKLEKLNTVPVEQQAEFKQLSDDIQELEQLLSHDYRRKTAALQEVISQKKSDITERTRKLNELKVTMATLKEEQEQLKSKIVESPEELKNYKELMKETVKKLKKSKQEVIEKYEGYRDLVEVLPSCQLEVQLYQKKMERQAANVERLASVLSEVRNLEDQLESAQIELKKGKTDEMSLKRLVTAKHERLSTAEIRIKKKREDVEQYKHTVFEYFNRVQEKRGVVYDKVTAIQKEIQQMRFKIQQLNESAEEEEMKAKEIYQNLKAGLEKRHDSLIKTAKNYAASREDKIAELQKGLLRVQSPGSSS cenph_kntc2_2 508577 N/A 508582 unspecified role unspecified role bait bait gal4 dbd n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 508583 unspecified role unspecified role prey prey gal4 tad n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 3A cenph_kntc2_3 508577 N/A 508584 unspecified role unspecified role prey prey gal4 tad n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 508585 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false gal4 dbd n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 3B cenph_kntc2_4 508577 N/A 508582 unspecified role unspecified role prey prey gal4 tad n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 508583 unspecified role unspecified role bait bait gal4 dbd n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 3A cenph_kntc2_5 508577 N/A 508585 unspecified role unspecified role prey prey gal4 tad n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 508584 unspecified role unspecified role bait bait gal4 dbd n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 3B kntc2_cenph_1 508578 N/A 508585 unspecified role unspecified role prey prey c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 508584 unspecified role unspecified role bait bait c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 4B cenph_mad2_1 508578 N/A 508586 unspecified role unspecified role prey prey c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 508585 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 4C cenph_spc24_1 508578 N/A 508587 unspecified role unspecified role prey prey c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 508585 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 4C cenph_spc25_1 508578 N/A 508588 unspecified role unspecified role prey prey c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 508585 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 4C cenpc_cenph_1 508579 N/A 508589 unspecified role unspecified role neutral component neutral component N/A 508585 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false Fig. 2 cenph_kntc2_6 508579 N/A 508584 unspecified role unspecified role neutral component neutral component c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 508585 unspecified role unspecified role neutral component neutral component c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Fig. 4A cenph_kntc2_1 508580 N/A 508582 unspecified role unspecified role bait bait gal4 dbd n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 508583 unspecified role unspecified role prey prey gal4 tad n-terminus tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false None. cenph_kntc2_7 508581 N/A 508590 unspecified role unspecified role prey prey N/A 508584 unspecified role unspecified role prey prey N/A 508585 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false association association false false false Fig. 4B and Fig. 5