IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ maita-2005-9 CIR, a corepressor of CBF1, binds to PAP-1 and effects alternative splicing. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip antibody detection identification by antibody antibody detection Maita H., Kitaura H., Ariga H., Iguchi-Ariga SM. Chromatin - Epigenetic interactions resulting in chromatin modulation Fig. 6C. and 6D. hiro@pharm.hokudai.ac.jp Exp. Cell Res. (0014-4827) 2005 maita-2005-8 CIR, a corepressor of CBF1, binds to PAP-1 and effects alternative splicing. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Maita H., Kitaura H., Ariga H., Iguchi-Ariga SM. Chromatin - Epigenetic interactions resulting in chromatin modulation Fig. 6A. and 6B. hiro@pharm.hokudai.ac.jp Exp. Cell Res. (0014-4827) 2005 maita-2005-1 CIR, a corepressor of CBF1, binds to PAP-1 and effects alternative splicing. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Maita H., Kitaura H., Ariga H., Iguchi-Ariga SM. Chromatin - Epigenetic interactions resulting in chromatin modulation hiro@pharm.hokudai.ac.jp Exp. Cell Res. (0014-4827) 2005 maita-2005-3 CIR, a corepressor of CBF1, binds to PAP-1 and effects alternative splicing. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Maita H., Kitaura H., Ariga H., Iguchi-Ariga SM. Chromatin - Epigenetic interactions resulting in chromatin modulation Fig.2B and Fig. 2C hiro@pharm.hokudai.ac.jp Exp. Cell Res. (0014-4827) 2005 maita-2005-2 CIR, a corepressor of CBF1, binds to PAP-1 and effects alternative splicing. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip antibody detection identification by antibody antibody detection Maita H., Kitaura H., Ariga H., Iguchi-Ariga SM. Chromatin - Epigenetic interactions resulting in chromatin modulation extracts were immunoprecipitated with anti-Flag antibody precipitates were blotted wtih anti-T7 antibody. Fig. 2A. hiro@pharm.hokudai.ac.jp Exp. Cell Res. (0014-4827) 2005 maita-2005-4 CIR, a corepressor of CBF1, binds to PAP-1 and effects alternative splicing. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip antibody detection identification by antibody antibody detection Maita H., Kitaura H., Ariga H., Iguchi-Ariga SM. Chromatin - Epigenetic interactions resulting in chromatin modulation immunoprecipitated wtih anti-FLAG, western blot analyzed with anti-T7 antibody. Fig. 2D. hiro@pharm.hokudai.ac.jp Exp. Cell Res. (0014-4827) 2005 maita-2005-5 CIR, a corepressor of CBF1, binds to PAP-1 and effects alternative splicing. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Maita H., Kitaura H., Ariga H., Iguchi-Ariga SM. Chromatin - Epigenetic interactions resulting in chromatin modulation proteins were detected by a rhodamine-conjugated second antibody and self-fluorescence. Fig. 4C. hiro@pharm.hokudai.ac.jp Exp. Cell Res. (0014-4827) 2005 maita-2005-6 CIR, a corepressor of CBF1, binds to PAP-1 and effects alternative splicing. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging anti tag immunost anti tag immunostaining anti tag immunost Maita H., Kitaura H., Ariga H., Iguchi-Ariga SM. Chromatin - Epigenetic interactions resulting in chromatin modulation stained wtih anti-SC35 monoclonal antibody. Fig. 5A. WT hiro@pharm.hokudai.ac.jp Exp. Cell Res. (0014-4827) 2005 maita-2005-7 CIR, a corepressor of CBF1, binds to PAP-1 and effects alternative splicing. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Maita H., Kitaura H., Ariga H., Iguchi-Ariga SM. Chromatin - Epigenetic interactions resulting in chromatin modulation stained wtih anti-HA antibody and proteins detected by self-fluorescence (from GFP-tag) and rhodamin-conjugated second antibody. Fig. 4Cd-i. hiro@pharm.hokudai.ac.jp Exp. Cell Res. (0014-4827) 2005 maita-2005-10 CIR, a corepressor of CBF1, binds to PAP-1 and effects alternative splicing. in vitro In vitro pull down pull down antibody detection identification by antibody antibody detection Maita H., Kitaura H., Ariga H., Iguchi-Ariga SM. Chromatin - Epigenetic interactions resulting in chromatin modulation Fig. 6E. hiro@pharm.hokudai.ac.jp Exp. Cell Res. (0014-4827) 2005 cir1_human Corepressor interacting with RBPJ 1 CIR CBF1-interacting corepressor Recepin CIR1 protein protein human Homo sapiens Human MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMGDERVKNGLNFMYEAPPGAKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFGIQVRNVRCIKCHKWGHVNTDRECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQEYVASEGEEDPEVEFLKSLTTKQKQKLLRKLDRLEKKKKKKDRKKKKFQKSRSKHKKHKSSSSSSSSSSSSSSTETSESSSESESNNKEKKIQRKKRKKNKCSGHNNSDSEEKDKSKKRKLHEELSSSHHNREKAKEKPRFLKHESSREDSKWSHSDSDKKSRTHKHSPEKRGSERKEGSSRSHGREERSRRSRSRSPGSYKQRETRKRAQRNPGEEQSRRNDSRSHGTDLYRGEKMYREHPGGTHTKVTQRE u2af1_human Splicing factor U2AF 35 kDa subunit U2 auxiliary factor 35 kDa subunit U2 snRNP auxiliary factor small subunit U2AF1 U2AF35 U2AFBP U2 small nuclear RNA auxiliary factor 1 FP793 protein protein human Homo sapiens Human MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDAEKAVIDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRELRRELYGRRRKKHRSRSRSRERRSRSRDRGRGGGGGGGGGGGGRERDRRRSRDRERSGRF srsf2_human Serine/arginine-rich splicing factor 2 Splicing factor SC35 Splicing component, 35 kDa Protein PR264 SRSF2 SFRS2 Splicing factor, arginine/serine-rich 2 protein protein human Homo sapiens Human MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGGGGYGRRSRSPRRRRRSRSRSRSRSRSRSRSRYSRSKSRSRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRSPPPVSKRESKSRSRSKSPPKSPEEEGAVSS srsf1_human Serine/arginine-rich splicing factor 1 SF2 SF2P33 OK/SW-cl.3 SRSF1 ASF pre-mRNA-splicing factor SF2, P33 subunit Alternative-splicing factor 1 SFRS1 Splicing factor, arginine/serine-rich 1 protein protein human Homo sapiens Human MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT rp9_mouse Retinitis pigmentosa 9 protein homolog Pim-1-associated protein rp9 Rp9h protein protein mouse Mus musculus Mouse MSSGAGSRRPREPPEHELQRRREQKRRRHDAQQLQQLKHLESFYEKPPPGFIKEDETKPEDCIPDVPGNEHAREFLAHAPTKGLWMPLGREVKVMQCWRCKRYGHRTGDKECPFFIKGNQKLEQFRVAHEDPMYDIIRENKRHEKDVRIQQLKQLLEDSTSDDDGSSSSSSGDREKRKKRKKKEKHKKRKKEKKKKKKRKHKASKSSESSDSE in80b_mouse INO80 complex subunit B PAP-1-associated protein 1 High mobility group AT-hook 1-like 4 Ino80b Hmga1l4 Papa1 Znhit4 Zinc finger HIT domain-containing protein 4 protein protein mouse Mus musculus Mouse MSACVPTVSSPLPLQDPMSKLWRRGSTSGAMEAPEPGETLELSLAGAHGHGVHKKKHKKHKKKHKKKHHQEEEAGPTLQTPAKPQLKLKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYRAWLDEDSNLSPSPLRDLPGDLEGQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPTLPLPVGGGCPAPALTEEMLLKREERARKRRLQAARRAEEHKNQTIERLTKTAAPSGRGGRGAARGERRGGRAAAPAPAPMVRYCSGAQGSTLSFPPGVPTPTAVAQRPAPSGPAPRCSVPGCPHPRRYACSRTGQALCSLQCYRINLQLRLGGPEGPGSPLLAT cir1_mouse Corepressor interacting with RBPJ 1 CBF1-interacting corepressor Cir Cir1 protein protein mouse Mus musculus Mouse MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMGDERVKNGLNFMYEAPPGVKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFGIQVRNVRCIKCHKWGHVNTDRECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQDYVASDCEEDPEVEFLKSLTTKQKQKLLRKLDRLEKKKKKKKSDKKKKKLQKSKNKHKKRKNKSPSSSSSSSSSSSSSSSSSSSSSSSSETSDSSSESDNKEKKREKEKRKKKKKTKCSESKSSDCKEDKPKNMLYEELSSSHSDRGKAQEKLRFPKQESSGENSMWVHSASDRTSRSHRHSPEKKGSDRNRGIRSRSRSRAESSRRSRSRSPYRQKHREVRSRPHRSPSEEQKGRKGTRSHGEGDHRREHVR rp9_human Retinitis pigmentosa 9 protein Pim-1-associated protein RP9 protein protein human Homo sapiens Human MSSRPGREDVGAAGARRPREPPEQELQRRREQKRRRHDAQQLQQLKHLESFYEKPPPGLIKEDETKPEDCIPDVPGNEHAREFLAHAPTKGLWMPLGKEVKVMQCWRCKRYGHRTGDKECPFFIKGNQKLEQFRVAHEDPMYDIIRDNKRHEKDVRIQQLKQLLEDSTSDEDRSSSSSSEGKEKHKKKKKKEKHKKRKKEKKKKKKRKHKSSKSNEGSDSE cir-u2af1-2 CIR interacts with SR proteins, as detected by mammalian coip. 205290 N/A 205300 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 205301 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false cir-sfrs2-2 CIR interacts with SR proteins, as detected by mammalian coip. 205290 N/A 205300 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 205302 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Results from the maita-2005-10 experiment suggest that interaction of CIR with sfrs2 and sfr1 requires some modifications in the RS domain of CIR or is mediated via other factors that bridge CIR to SR proteins. cir-sfrs1-3 CIR interacts with SR proteins, as detected by mammalian coip. 205290 N/A 205300 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 205303 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Results from the maita-2005-10 experiment suggest that interaction of CIR with sfrs2 and sfr1 requires some modifications in the RS domain of CIR or is mediated via other factors that bridge CIR to SR proteins. cir-sfrs2-3 CIR interacts with SR proteins, as detected by mammalian coip. 205290 N/A 205302 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 205300 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Results from the maita-2005-10 experiment suggest that interaction of CIR with sfrs2 and sfr1 requires some modifications in the RS domain of CIR or is mediated via other factors that bridge CIR to SR proteins. cir-u2af1-3 CIR interacts with SR proteins, as detected by mammalian coip. 205290 N/A 205300 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 205301 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false cir-sfrs1-2 CIR interacts with SR proteins, as detected by mammalian coip. 205290 N/A 205300 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 205303 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Results from the maita-2005-10 experiment suggest that interaction of CIR with sfrs2 and sfr1 requires some modifications in the RS domain of CIR or is mediated via other factors that bridge CIR to SR proteins. cir-sfrs2-1 CIR interacts with SR proteins, as detected by Y2H. 205291 N/A 205302 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 205300 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false region 234-297AA of CIR was found to be unimportant for this interaction. Results from the maita-2005-10 experiment suggest that interaction of CIR with sfrs2 and sfr1 requires some modifications in the RS domain of CIR or is mediated via other factors that bridge CIR to SR proteins. cir-u2af1-1 CIR interacts with SR proteins, as detected by Y2H. 205291 N/A 205301 unspecified role unspecified role bait bait region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 205300 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false cir-sfrs1-1 CIR interacts with SR proteins, as detected by Y2H. 205291 N/A 205300 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 205303 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false region 234-297AA of CIR was found to be unimportant for this interaction. Results from the maita-2005-10 experiment suggest that interaction of CIR with sfrs2 and sfr1 requires some modifications in the RS domain of CIR or is mediated via other factors that bridge CIR to SR proteins. rp9-hmga1l4-1 CIR, a corepressor of CBF1, binds to PAP-1 and effects alternative splicing 205292 N/A 205304 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 205305 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rp9-1700023b02rik-1 CIR, a corepressor of CBF-1, binds to PAP-1 and effects alternative splicing. 205292 N/A 205304 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 205306 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rp9-1700023b02rik-3 Association of CIR wtih PAP-1, as detected by mammalian 2-hybrid 205293 N/A 205306 unspecified role unspecified role bait bait human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 205304 unspecified role unspecified role prey prey region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false rp9-1700023b02rik-4 Association of CIR with PAP-1, as detected by mammalian Y2H. 205293 N/A 205306 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 205304 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false rp9-1700023b02rik-2 CIR, a corepressor of CBF-1, binds to PAP-1, as detected by co-ip. 205294 N/A 205304 unspecified role unspecified role prey prey region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 205306 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false 1700023b02rik-rp9 Association of CIR with PAP-1, as detected by anti-tag co-ip. 205295 N/A 205306 unspecified role unspecified role prey prey region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 205304 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false Only wild-type CIR (Q9DA19) and not deletion AA203-232 CIR was co-immunoprecipitated with FLAG-PAP-1. 1700023b02rik-rp9-5 Colocalization of PAP-1 and CIR, as detected by co-immunofluorescence. 205296 N/A 205306 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 205304 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization false false false sfrs2-1700023b02rik Nuclear localization of CIR is overlapped wtih that of SR proteins in nuclear speckles. 205297 N/A 205300 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 205302 unspecified role unspecified role neutral component neutral component human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization false false false rp9-sfrs1-1 PAP-1 interacts with the SR complex, as detected by colocalization. 205298 N/A 205307 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 205303 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 colocalization colocalization false false false It was determined from a previous experiment that Q8TA86 does not directly bind Q07955, however the results from this experiment indicate that PAP-1 is involved in the SR protein complex and that PAP-1 might directly associate wtih CIR or U2AF35 cir-u2af1-4 CIR interacts with u2af1, as detected by anti-GST pull down. 205299 N/A 205301 unspecified role unspecified role prey prey 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 205300 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false