IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ chattopadhy-2004-2 Human p32, interacts with B subunit of the CCAAT-binding factor, CBF/NF-Y, and inhibits CBF-mediated transcription activation in vitro. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip monoclonal western monoclonal antibody western blot monoclonal western Chattopadhyay C., Hawke D., Kobayashi R., Maity SN. Chromatin - Epigenetic interactions resulting in chromatin modulation Nucleic Acids Res. (0305-1048) 2004 chattopadhy-2004-1 Human p32, interacts with B subunit of the CCAAT-binding factor, CBF/NF-Y, and inhibits CBF-mediated transcription activation in vitro. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 biochemical biochemical fingerprinting peptide massfingerprinting fingerprinting Chattopadhyay C., Hawke D., Kobayashi R., Maity SN. Chromatin - Epigenetic interactions resulting in chromatin modulation Nucleic Acids Res. (0305-1048) 2004 chattopadhy-2004-3 Human p32, interacts with B subunit of the CCAAT-binding factor, CBF/NF-Y, and inhibits CBF-mediated transcription activation in vitro. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 imaging technique imaging technique microscopy immunostaining immunostaining Chattopadhyay C., Hawke D., Kobayashi R., Maity SN. Chromatin - Epigenetic interactions resulting in chromatin modulation Nucleic Acids Res. (0305-1048) 2004 srsf1_human Serine/arginine-rich splicing factor 1 SF2 SF2P33 OK/SW-cl.3 SRSF1 ASF pre-mRNA-splicing factor SF2, P33 subunit Alternative-splicing factor 1 SFRS1 Splicing factor, arginine/serine-rich 1 protein protein human Homo sapiens Human MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT nfyc_human Nuclear transcription factor Y subunit gamma NFYC Nuclear transcription factor Y subunit C CAAT box DNA-binding protein subunit C Transactivator HSM-1/2 protein protein human Homo sapiens Human MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQGQRNASQGKPRRCLKETLQITQTEVQQGQQQFSQFTDGQRNSVQQARVSELTGEAEPREVKATGNSTPCTSSLPTTHPPSHRAGASCVCCSQPQQSSTSPPPSDALQWVVVEVSGTPNQLETHRELHAPLPGMTSLSPLHPSQQLYQIQQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGD nfya_human Nuclear transcription factor Y subunit alpha NFYA Nuclear transcription factor Y subunit A CAAT box DNA-binding protein subunit A protein protein human Homo sapiens Human MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS nfyb_human Nuclear transcription factor Y subunit beta NFYB HAP3 Nuclear transcription factor Y subunit B CAAT box DNA-binding protein subunit B protein protein human Homo sapiens Human MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISGVQQIQFS cbfa-cbfb Components of the CBF complex confirmed by coimmunoprecipitation 134745 N/A 134748 unspecified role unspecified role prey prey N/A 134749 unspecified role unspecified role prey prey N/A 134750 unspecified role unspecified role bait bait N/A 134751 unspecified role unspecified role prey prey association association false false false CBFB HA-tagged cbfb-p32-1 Interaction between CBFB and p32 demonstrated by coimmunoprecipitation 134745 N/A 134748 unspecified role unspecified role prey prey N/A 134750 unspecified role unspecified role bait bait physical association physical association false false false p32 also shown to associate with CBFB when it is present in a CBF-DNA complex cbfb-p32-2 Interaction between CBFB and p32 confirmed by coimmunoprecipitation 134745 N/A 134748 unspecified role unspecified role bait bait N/A 134750 unspecified role unspecified role prey prey physical association physical association false false false p32 myc-tagged CBFB only binds to mature (75-282) p32, not full length protein cbfa-cbfb-1 Formation of CBFcomplex identified by mass spectrometry 134746 N/A 134748 unspecified role unspecified role prey prey N/A 134751 unspecified role unspecified role prey prey N/A 134749 unspecified role unspecified role prey prey N/A 134750 unspecified role unspecified role bait bait physical association physical association false false false CBFB HA-tagged and proteins co-purified on HA affinity resin Identitiy of p32 protein made by analysis of 9 tryptic polypeptides and confirmed by western blotting using monoclonal ant-p32 antibodies. cbfb-p32-3 Colocalisation of CBFB and p32 demonstrated by immunostaining 134747 N/A 134748 unspecified role unspecified role neutral component neutral component N/A 134750 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false