IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ klenova-2004-1 YB-1 and CTCF differentially regulate the 5-HTT polymorphic intron 2 enhancer which predisposes to a variety of neurological disorders. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 1 hybrid one hybrid yeast one-hybrid yeast one hybrid one-hybrid 1 hybrid yeast one-hybrid one-hybrid yeast one hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Klenova E., Scott AC., Roberts J., Shamsuddin S., Lovejoy EA., Bergmann S., Bubb VJ., Royer HD., Quinn JP. Chromatin - Epigenetic interactions resulting in chromatin modulation klenovae@essex.ac.uk Human fetal brain MATCHMAKER cDNA library J. Neurosci. (0270-6474) 2004 Only protein-protein interactions imex curation klenova-2004-2 YB-1 and CTCF differentially regulate the 5-HTT polymorphic intron 2 enhancer which predisposes to a variety of neurological disorders. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Klenova E., Scott AC., Roberts J., Shamsuddin S., Lovejoy EA., Bergmann S., Bubb VJ., Royer HD., Quinn JP. Chromatin - Epigenetic interactions resulting in chromatin modulation Bait protein was purified and immobilised on sepharose matrix. 4C klenovae@essex.ac.uk Human fetal brain MATCHMAKER cDNA library J. Neurosci. (0270-6474) 2004 Only protein-protein interactions imex curation klenova-2004-3 YB-1 and CTCF differentially regulate the 5-HTT polymorphic intron 2 enhancer which predisposes to a variety of neurological disorders. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Klenova E., Scott AC., Roberts J., Shamsuddin S., Lovejoy EA., Bergmann S., Bubb VJ., Royer HD., Quinn JP. Chromatin - Epigenetic interactions resulting in chromatin modulation 4D klenovae@essex.ac.uk Human fetal brain MATCHMAKER cDNA library J. Neurosci. (0270-6474) 2004 Only protein-protein interactions imex curation ybox1_human Y-box-binding protein 1 YBX1 YB1 NSEP1 Y-box transcription factor CCAAT-binding transcription factor I subunit A Enhancer factor I subunit A DNA-binding protein B Nuclease-sensitive element-binding protein 1 protein protein human Homo sapiens Human MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE stin2_10 Region used is VNTR repeat 9 and 10 in the intron 2 of seratonin gene. dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human ctcf_chick Transcriptional repressor CTCF CCCTC-binding factor CTCFL paralog 11-zinc finger protein CTCF protein protein chick Gallus gallus (Chicken) Chicken MEGEAVEAIVEESETFIKGKERKTYQRRREGGQEDEACHIAPNQADGGEVVQDVNSGVQMVMMEHLDPTLLQMKTEVMEGAVPQETEATVDDTQIITLQVVNMEEQPINLGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKGGLQEGEPMICHTLPLPEGFQVVKVGANGEVETLEQGELQPQEDPNWQKDPDYQPPAKKTKKNKKSKLRYTEEGKDVDVSVYDFEEEQQEGLLSEVNAEKVVGNMKPPKPTKIKKKGVKKTFQCELCSYTCPRRSNLDRHMKSHTDERPHKCHLCGRAFRTVTLLRNHLNTHTGTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQKSHKNEKRFKCDQCDYACRQERHMVMHKRTHTGEKPYACSHCDKTFRQKQLLDMHFKRYHDPNFVPAAFVCSKCGKTFTRRNTMARHADNCSGLDGGEGENGGETKKGKRGRKRKMRSKKEDSSDSEENAEPDLDDNEDEEETAVEIEAEPEVSAEAPAPPPSKKRRGRPPGKAATQTKQSQPAAIIQVEDQNTGEIENIIVEVKKEPDAETVEEEEEAQPAVVEAPNGDLTPEMILSMMDR stin2_10-ybx1 367310 N/A 367313 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 367314 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false ybx1-ctcf 367311 N/A 367313 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 367315 unspecified role unspecified role bait bait zf domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false ybx1-ctcf-1 367312 N/A 367315 unspecified role unspecified role prey prey zf domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 367313 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false