IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ehsan-2004-2 TOUSLED kinase activity oscillates during the cell cycle and interacts with chromatin regulators. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ehsan H., Reichheld JP., Durfee T., Roe JL. Chromatin - Epigenetic interactions resulting in chromatin modulation jroe@ksu.edu Arabidopsis cDNA library made from aerial parts of the palnt including flowers. Plant Physiol. (0032-0889) 2004 Only protein-protein interactions imex curation ehsan-2004-3 TOUSLED kinase activity oscillates during the cell cycle and interacts with chromatin regulators. in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography Ehsan H., Reichheld JP., Durfee T., Roe JL. Chromatin - Epigenetic interactions resulting in chromatin modulation The source organism of the MBP or Histone 3 proteins could not be established and interactions involving this proteins were therefore not curated. jroe@ksu.edu Arabidopsis cDNA library made from aerial parts of the palnt including flowers. Plant Physiol. (0032-0889) 2004 Only protein-protein interactions imex curation ehsan-2004-1 TOUSLED kinase activity oscillates during the cell cycle and interacts with chromatin regulators. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ehsan H., Reichheld JP., Durfee T., Roe JL. Chromatin - Epigenetic interactions resulting in chromatin modulation jroe@ksu.edu Arabidopsis cDNA library made from aerial parts of the palnt including flowers. Plant Physiol. (0032-0889) 2004 Only protein-protein interactions imex curation tki1_arath TSL-kinase interacting protein 1 TKI1 Myb-related protein TKI1 T1J8.14 At2g36960 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLKQFTHYCEMQAELIPEGPNGEGRLSNQNSNPNLLSSASISITQFPAKKPTRQWAAWTHQEEESFFTALRQVGKNFEKITSRVQSKNKDQVRHYYYRLVRRMNKLLGPDLSLDAKNPKDTNAAMLRWWSLLEKYSCKASKLHLKPRRFKLFIEALEHQLLKDRRKSIRKRTCQGENLSSASLGNISSHSRERGLDNRPFKLILSDGQNVKKLGPGRASTKHGESLSVNLGDEKEDTAFGRGGRQRRKQGYRKWEKAAIDGVSLVADAAEHLERTSIDKDMDDQTDLGPTRYLTGKSPLSLCSAGDVPLSDANMQFSAKLKLQLFPIDECTRRSLEMDKHNPHLELTLSNRKKISSVLEHLNRKWGSSSCATGELLLFPYNARKETVTCHQRWTHDSFLSAAEVHSMVGSPSVFRLRYGWFVHDASGSIISQVPTSDPCPSLEDDMNVDRLNEVNMLLTESGPLSVHSTAEQTTSVEPSQGLVCASGVHDRPARSRDDYEPASTSITPLEHLSGGNAQSPGEWADSLTNISIGDLLSEVPDDIDSDGVDPPATEGSHYLLRDVPFTSDSFDAAIAAHILRHQNKPSAQLPLTSGSSSLWDDEETRDAFSFQKNRFANSTELASVASPKGVGRVNGEPSQLVEASSGDEGSYNPHDDGDPMEEGPADPHTMDSPGKTPCGLADVYWPDSLGPLDLDIRSSKYTDDLILSESLGGLSRLIATSLDAFQNCSLFGFDNKKDKSNMV tsl_arath Serine/threonine-protein kinase TOUSLED TOUSLED TSL F22D1.100 At5g20930 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSDDMVLHFSSNSSNQSDHSLPDKIAKLEARLTGKTPSSAKPPQQQQQQQQQVSLWSSASAAVKVVTSTPPGLSETSISDSDDENTGDFLIRANTKKRQKVQESNNFSVVDHVEPQEAAYDGRKNDAESKTGLDVSKKKQGRGRASSTGRGRGSKTNNDVTKSQFVVAPVSAASQLDASDQKDFRPDGQLRNGECSLQDEDLKSLRAKIAMLEEELRKSRQDSSEYHHLVRNLENEVKDLKDQEQQGKQKTTKVISDLLISVSKTERQEARTKVRNESLRLGSVGVLRTGTIIAETWEDGQMLKDLNAQLRQLLETKEAIERQRKLLKKRQNGDKNDGTDTESGAQEEDIIPDEVYKSRLTSIKREEEAVLRERERYTLEKGLLMREMKRIRDEDGSRFNHFPVLNSRYALLNLLGKGGFSEVYKAYDLVDHRYVACKLHGLNAQWSEEKKQSYIRHANRECEIHKSLVHHHIVRLWDKFHIDMHTFCTVLEYCSGKDLDAVLKATSNLPEKEARIIIVQIVQGLVYLNKKSQKIIHYDLKPGNVLFDEFGVAKVTDFGLSKIVEDNVGSQGMELTSQGAGTYWYLPPECFELNKTPMISSKVDVWSVGVLFYQMLFGKRPFGHDQSQERILREDTIIKAKKVEFPVTRPAISNEAKDLIRRCLTYNQEDRPDVLTMAQDPYLAYSKK asf1b_arath Histone chaperone ASF1B ASF1B SGA01 SGA1 Anti-silencing function protein 1-like protein b Silencing group A protein 1 F16F17.110 At5g38110 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSINITNVTVLDNPAPFVNPFQFEISYECLTSLKDDLEWKLIYVGSAEDETYDQVLESVLVGPVNVGNYRFVLQADSPDPLKIREEDIIGVTVLLLTCSYMDQEFIRVGYYVNNDYDDEQLREEPPTKVLIDKVQRNILTDKPRVTKFPINFHPENEQTLGDGPAPTEPFADSVVNGEAPVFLEQPQKLQEIEQFDDSDVNGEAIALLDQPQNLQET tsl-tkl1-1 833767 n/a 833770 unspecified role unspecified role prey prey n/a 833771 unspecified role unspecified role bait bait range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q39238:p.Lys438Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 5 tsl-asfb 833767 n/a 833772 unspecified role unspecified role prey prey n/a 833771 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q39238:p.Lys438Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 7 tsl-tkl1-2 833767 n/a 833771 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q39238:p.Lys438Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false n/a 833770 unspecified role unspecified role prey prey c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false 833788 833785 physical association physical association false false false Figs. 5 and 7 TSL interacts approximately fourfold more strongly with the full-length TKI1 protein. tsl-tsl1 833768 n/a 833771 putative self putative self putative self putative self Q39238:p.Lys438Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast phosphorylation phosphorylation reaction phosphorylation false true false Figure 8 autophosphorylation tsl-asf1b 833768 n/a 833771 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q39238:p.Lys438Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 833772 enzyme target enzyme target substrate substrate neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast phosphorylation phosphorylation reaction phosphorylation false false false Figure 8 phosphorylation of Q9LS09 tsl-tkl1-3 833768 n/a 833771 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q39238:p.Lys438Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 833770 enzyme target enzyme target substrate substrate neutral component neutral component c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false Figure 8 phosphorylation of Q8LJT8 tsl-tkl1 833769 n/a 833770 unspecified role unspecified role prey prey n/a 833771 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false