IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ balicky-2004-1 A proposed role for the Polycomb group protein dRING in meiotic sister-chromatid cohesion. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Balicky EM., Young L., Orr-Weaver TL., Bickel SE. Chromatin - Epigenetic interactions resulting in chromatin modulation 1A, 1B sharon.e.bickel@dartmouth.edu Ovarian cDNA library Chromosoma (0009-5915) 2004 Only protein-protein interactions imex curation balicky-2004-2 A proposed role for the Polycomb group protein dRING in meiotic sister-chromatid cohesion. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Balicky EM., Young L., Orr-Weaver TL., Bickel SE. Chromatin - Epigenetic interactions resulting in chromatin modulation Directed yeast two hybrid. 1A, 1B sharon.e.bickel@dartmouth.edu Ovarian cDNA library Chromosoma (0009-5915) 2004 Only protein-protein interactions imex curation balicky-2004-3 A proposed role for the Polycomb group protein dRING in meiotic sister-chromatid cohesion. drome Drosophila melanogaster (Fruit fly) Fruit fly fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Balicky EM., Young L., Orr-Weaver TL., Bickel SE. Chromatin - Epigenetic interactions resulting in chromatin modulation Drosophila primary spermatocytes were used. 1A, 1B sharon.e.bickel@dartmouth.edu Ovarian cDNA library Chromosoma (0009-5915) 2004 Only protein-protein interactions imex curation ring1_drome E3 ubiquitin-protein ligase RING1 Sce CG5595 dRING1 dRING protein Sex comb extra protein RING-type E3 ubiquitin transferase RING1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MTSLDPAPNKTWELSLYELQRKPQEVITDSTEIAVSPRSLHSELMCPICLDMLKKTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRADPNFDLLISKIYPSREEYEAIQEKVMAKFNQTQSQQALVNSINEGIKLQSQNRPQRFRTKGGGGGGGGGGNGNGAANVAAPPAPGAPTAVGRNASNQMHVHDTASNDSNSNTNSIDRENRDPGHSGTSAASAITSASNAAPSSSANSGASTSATRMQVDDASNPPSVRSTPSPVPSNSSSSKPKRAMSVLTSERSEESESDSQMDCRTEGDSNIDTEGEGNGELGINDEIELVFKPHPTEMSADNQLIRALKENCVRYIKTTANATVDHLSKYLAMRLTLDLGADLPEACRVLNFCIYVAPQPQQLVILNGNQTLHQVNDKFWKVNKPMEMYYSWKKT ord_drome Protein ORD ord CG3134 Orientation disrupter protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MYGETTLNKNHVIKFIKLKINNCLGCDEVEINFSKADNVHIIIYSLVTDMAKDLPAVTPVAQAILLLCSLTYPDSDSLETIPQLKIGKGSVSMSFKVYPVNKEEETEPESESDLDEGPSTSKQALERMVQRAERKAKEASTRNVHSKGIYVNVERRFDMYFALDTVSYYINGGKRQSCPLPEFHAKFFVRPQHSINLLRQLHEKCSGNWLKVIQSDGDGDAFKKFKDPDSPFETFVKLFESNPIKPNDMMGKLAKTCLHVNEAVRLTEREFILEVFNQVRHIFEYITAQEYTVWFLVPCLGDKDQLRSKTLEDFDLTKVRTSIRRAGDTSNIWWDHTDHNIKDILLVAFQLDLATHVNQSVLVISHLETLAEFSTMQYVTAFFMNDFYAKKNTEPKWICHRYLERIIDVALFLGVIVIIEYPSAFTLLQEGRHLIKCFQKENADSSRTSQWEIFEDVVKENESDLEFLKEAVGKVQQNV ord-dring 364225 N/A 364228 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 364229 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false ord-dring-1 364226 N/A 364229 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false Q24434:p.Val417Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false N/A 364228 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false ord-dring-2 364227 N/A 364229 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 364228 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Drosophila primary spermatocytes during G2 of meiosis