IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kohler-2003-2 Arabidopsis MSI1 is a component of the MEA/FIE Polycomb group complex and required for seed development. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kohler C., Hennig L., Bouveret R., Gheyselinck J., Grossniklaus U., Gruissem W. Chromatin - Epigenetic interactions resulting in chromatin modulation Gel filtration of nuclear extracts from arabidopsis inflorecenses was undertaken in this study. Figure 4 (c). wilhelm.gruissem@ipw.biol.ethz.ch EMBO J. (0261-4189) 2003 kohler-2003-1 Arabidopsis MSI1 is a component of the MEA/FIE Polycomb group complex and required for seed development. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Kohler C., Hennig L., Bouveret R., Gheyselinck J., Grossniklaus U., Gruissem W. Chromatin - Epigenetic interactions resulting in chromatin modulation Gel filtration of nuclear extracts from arabidopsis inflorecenses was undertaken in this study. Figure 4 (c). wilhelm.gruissem@ipw.biol.ethz.ch EMBO J. (0261-4189) 2003 kohler-2003-3 Arabidopsis MSI1 is a component of the MEA/FIE Polycomb group complex and required for seed development. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kohler C., Hennig L., Bouveret R., Gheyselinck J., Grossniklaus U., Gruissem W. Chromatin - Epigenetic interactions resulting in chromatin modulation Gel filtration of nuclear extracts from arabidopsis inflorecenses was undertaken in this study. Figure 4 (c). wilhelm.gruissem@ipw.biol.ethz.ch EMBO J. (0261-4189) 2003 fie_arath Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM FIE FIS3 At3g20740 MOE17.5 Protein FERTILIZATION-INDEPENDENT SEED 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKITLGNESIVGSLTPSNKKSYKVTNRIQEGKKPLYAVVFNFLDARFFDVFVTAGGNRITLYNCLGDGAISALQSYADEDKEESFYTVSWACGVNGNPYVAAGGVKGIIRVIDVNSETIHKSLVGHGDSVNEIRTQPLKPQLVITASKDESVRLWNVETGICILIFAGAGGHRYEVLSVDFHPSDIYRFASCGMDTTIKIWSMKEFWTYVEKSFTWTDDPSKFPTKFVQFPVFTASIHTNYVDCNRWFGDFILSKSVDNEILLWEPQLKENSPGEGASDVLLRYPVPMCDIWFIKFSCDLHLSSVAIGNQEGKVYVWDLKSCPPVLITKLSHNQSKSVIRQTAMSVDGSTILACCEDGTIWRWDVITK msi1_arath Histone-binding protein MSI1 Protein MULTICOPY SUPPRESSOR OF IRA 1 Protein medicis MSI1 WD-40 repeat-containing protein MSI1 MCK7.10 At5g58230 CAF-1 p48 homolog Chromatin assembly factor 1 subunit MSI1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGKDEEEMRGEIEERLINEEYKIWKKNTPFLYDLVITHALEWPSLTVEWLPDREEPSGKDYSVQKMILGTHTSESEPNYLMLAQVQLPLDDTESEARQYDDDRSEFGGFGCATGKVQIIQQINHDGEVNRARYMPQNPFIIATKTVNAEVYVFDYSKHPSKPPLDGACNPDLKLRGHSSEGYGLSWSKFKQGHLLSGSDDAQICLWDINATPKNKSLDAQQIFKAHEGVVEDVAWHLRHEYLFGSVGDDQYLLIWDLRSPSASKPVQSVVAHSMEVNCLAFNPFNEWVVATGSTDKTVKLFDLRKLSTALHTFDSHKEEVFQVGWNPKNETILASCCLGRRLMVWDLSRIDEEQTVEDAEDGPPELLFIHGGHTSKISDFSWNPCEDWVISSVAEDNILQIWQMAENIYHDEDDAPGEEPSKAS medea_arath Histone-lysine N-methyltransferase MEDEA EMB173 Maternal embryogenesis control protein Protein FERTILIZATION-INDEPENDENT SEED 1 Protein SET DOMAIN GROUP 5 Protein EMBRYO DEFECTIVE 173 MEA FIS1 At1g02580 T14P4.11 MEDEA SDG5 SET5 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEKENHEDDGEGLPPELNQIKEQIEKERFLHIKRKFELRYIPSVATHASHHQSFDLNQPAAEDDNGGDNKSLLSRMQNPLRHFSASSDYNSYEDQGYVLDEDQDYALEEDVPLFLDEDVPLLPSVKLPIVEKLPRSITWVFTKSSQLMAESDSVIGKRQIYYLNGEALELSSEEDEEDEEEDEEEIKKEKCEFSEDVDRFIWTVGQDYGLDDLVVRRALAKYLEVDVSDILERYNELKLKNDGTAGEASDLTSKTITTAFQDFADRRHCRRCMIFDCHMHEKYEPESRSSEDKSSLFEDEDRQPCSEHCYLKVRSVTEADHVMDNDNSISNKIVVSDPNNTMWTPVEKDLYLKGIEIFGRNSCDVALNILRGLKTCLEIYNYMREQDQCTMSLDLNKTTQRHNQVTKKVSRKSSRSVRKKSRLRKYARYPPALKKTTSGEAKFYKHYTPCTCKSKCGQQCPCLTHENCCEKYCGCSKDCNNRFGGCNCAIGQCTNRQCPCFAANRECDPDLCRSCPLSCGDGTLGETPVQIQCKNMQFLLQTNKKILIGKSDVHGWGAFTWDSLKKNEYLGEYTGELITHDEANERGRIEDRIGSSYLFTLNDQLEIDARRKGNEFKFLNHSARPNCYAKLMIVRGDQRIGLFAERAIEEGEELFFDYCYGPEHADWSRGREPRKTGASKRSKEARPAR fie-msl1 Anti-bait coimmunoprecipitation analysis reveals interaction between the FIE protein and the MSL1 protein 207438 N/A 207441 unspecified role unspecified role bait bait N/A 207442 unspecified role unspecified role prey prey physical association physical association false false false mea-msl1-1 Anti-bait coimmunoprecipitation analysis reveals interaction between the MEA protein and the MSL1 protein 207438 N/A 207443 unspecified role unspecified role bait bait N/A 207442 unspecified role unspecified role prey prey physical association physical association false false false fie-mea-1 Size exclusion chromatography reveals a complex containing the FIE protein, MEA protein and MSL1 protein 207439 N/A 207443 unspecified role unspecified role neutral component neutral component N/A 207442 unspecified role unspecified role neutral component neutral component N/A 207441 unspecified role unspecified role neutral component neutral component physical association physical association false false false FIE, MEA and MSL1 co-eluted in a 600kDa complex. msl1-fie GST pulldown analysis reveals interaction between the MSL1 protein and the FIE protein 207440 N/A 207442 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 207441 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false