IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhang-2003a-1 Structural basis for the product specificity of histone lysine methyltransferases. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhang X., Yang Z., Khan SI., Horton JR., Tamaru H., Selker EU., Cheng X. Chromatin - Epigenetic interactions resulting in chromatin modulation xcheng@emory.edu Mol. Cell (1097-2765) 2003 zhang-2003a-2 Structural basis for the product specificity of histone lysine methyltransferases. in vitro In vitro enzymatic study enzymatic study ms participant Identification by mass spectrometry ms participant Zhang X., Yang Z., Khan SI., Horton JR., Tamaru H., Selker EU., Cheng X. Chromatin - Epigenetic interactions resulting in chromatin modulation Methyl transferase activity of DIM 5 was tested on three synthetic peptides corresponding to the histone H3 N-terminal residues 1 to 15, 1 to 13, and 5 to 15 The origin of the Dim 5 protein taken from PMID 12372305 xcheng@emory.edu Mol. Cell (1097-2765) 2003 h3_neucr Histone H3 hh3 B7K22.030 NCU01635 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQESVESYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERN s-adenosyl-l-homocysteine S-adenosyl-l-homocysteine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) dim5_neucr Histone-lysine N-methyltransferase, H3 lysine-9 specific dim-5 dim-5 29E8.110 NCU04402 Histone H3-K9 methyltransferase dim-5 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MEKAFRPHFFNHGKPDANPKEKKNCHWCQIRSFATHAQLPISIVNREDDAFLNPNFRFIDHSIIGKNVPVADQSFRVGCSCASDEECMYSTCQCLDEMAPDSDEEADPYTRKKRFAYYSQGAKKGLLRDRVLQSQEPIYECHQGCACSKDCPNRVVERGRTVPLQIFRTKDRGWGVKCPVNIKRGQFVDRYLGEIITSEEADRRRAESTIARRKDVYLFALDKFSDPDSLDPLLAGQPLEVDGEYMSGPTRFINHSCDPNMAIFARVGDHADKHIHDLALFAIKDIPKGTELTFDYVNGLTGLESDAHDPSKISEMTKCLCGTAKCRGYLW 2C97AB4B5E582D88 dim5-h3 653307 N/A 653309 unspecified role unspecified role neutral component neutral component n terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 653310 unspecified role unspecified role neutral component neutral component N/A 653311 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false working 22.0%, free 32.0% 2.59 A Table 1 dim5-h3-1 653308 N/A 653309 unspecified role unspecified role neutral component neutral component n terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 653311 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false Figure 2 Trimethylated lysine was the main product for all three substrates. Among them, H3 1 to 15 was by far the best substrate, synthesizing trimethylated product 15 to 20 times faster than the other two peptides. Trimethylated peptide H3 (1-15) was the best substrate, synthesizing trimethylated product 15 to 20 times faster than the other two peptides studied H3(6-16) and H3(2-14).