IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tie-2003-4 A 1-megadalton ESC/E(Z) complex from Drosophila that contains polycomblike and RPD3. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Tie F., Prasad-Sinha J., Birve A., Rasmuson-Lestander A., Harte PJ. Chromatin - Epigenetic interactions resulting in chromatin modulation 0-16 hour whole embryo extracts used for CoIP Mol. Cell. Biol. (0270-7306) 2003 tie-2003-1 A 1-megadalton ESC/E(Z) complex from Drosophila that contains polycomblike and RPD3. drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tie F., Prasad-Sinha J., Birve A., Rasmuson-Lestander A., Harte PJ. Chromatin - Epigenetic interactions resulting in chromatin modulation 0-16 hour whole embryo extracts used for CoIP Mol. Cell. Biol. (0270-7306) 2003 tie-2003-2 A 1-megadalton ESC/E(Z) complex from Drosophila that contains polycomblike and RPD3. drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Tie F., Prasad-Sinha J., Birve A., Rasmuson-Lestander A., Harte PJ. Chromatin - Epigenetic interactions resulting in chromatin modulation 0-16 hour whole embryo extracts used for CoIP Mol. Cell. Biol. (0270-7306) 2003 tie-2003-3 A 1-megadalton ESC/E(Z) complex from Drosophila that contains polycomblike and RPD3. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Tie F., Prasad-Sinha J., Birve A., Rasmuson-Lestander A., Harte PJ. Chromatin - Epigenetic interactions resulting in chromatin modulation 0-16 hour whole embryo extracts used for CoIP Mol. Cell. Biol. (0270-7306) 2003 tie-2003-5 A 1-megadalton ESC/E(Z) complex from Drosophila that contains polycomblike and RPD3. drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Tie F., Prasad-Sinha J., Birve A., Rasmuson-Lestander A., Harte PJ. Chromatin - Epigenetic interactions resulting in chromatin modulation 0-16 hour whole embryo extracts used for CoIP Mol. Cell. Biol. (0270-7306) 2003 tie-2003-6 A 1-megadalton ESC/E(Z) complex from Drosophila that contains polycomblike and RPD3. drome-salivary_gland Drosophila melanogaster Salivary gland salivary_gland Salivary gland imaging technique imaging technique microscopy immunostaining immunostaining Tie F., Prasad-Sinha J., Birve A., Rasmuson-Lestander A., Harte PJ. Chromatin - Epigenetic interactions resulting in chromatin modulation 0-16 hour whole embryo extracts used for CoIP Mol. Cell. Biol. (0270-7306) 2003 hdac1_drome Histone deacetylase HDAC1 HDAC1 Rpd3 CG7471 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQSHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDEYVRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDAYESIFVPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGGYTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKIKNRLFENLRMLPHAPGVQIQAIPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENEYSDSEDEGEGGRRDNRSYKGQRKRPRLDKDTNSNKASSETSSEIKDEKEKGDGADGEESTASNTNSNNNSNNKSDNDAGATANAGSGSGSGSGAGAKGAKENNI pcl_drome Polycomb protein Pcl Polycomblike protein Pcl CG5109 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MMNNHFHLQHDHPPQNVAHPFMQQPSTAVPSAPPATYGYLAQPAGQQPQWMTTTYQILPPSVGPATVAKRYYATTGPQTTHPTHPSTIQITNSFAQQSTPPKQQAATSCSPFKANNIRIISTAPSVYSLNKPPQEAHSTYAPVQSYYLPSGGGQTAGQINLLAASGTGKQLQPPPLVPVTNSTSPPSTVVLDRINICINNHYTETPTSLSSSLTTAQQPSPIIPAIQHKAILPLIDSSTADSSSCSSSSVSSSSYSGTATTSAAVVIVDEPDSTTTTPQTPPTTPEAMSSPGKSSPSPPLLATQSLLKGVNSMKPSFKTVEAAPPTPPTPPSPPPPPPAPPVAAPSPAVTYALQEDVFIKCNDGRFYLGTIIDQTSDQYLIRFDDQSEQWCEPDKLRKLGGGSSITAGGGGASTTESTNTSPSGPMCVACKRSDIEDVVEICERCGRGYHRGCTVEIVTGSGIWSCKRCAKPMKMQQPVSHKITKPAGICRQLPYHADKLSWDEKHRVNEEQIYCYCGKPGKFDHNMLQCCKCRNWFHTQCMQNFKKKLLRGDMFFVFCCTVCNNGIEFVRRMQIEWVDVLHIALYNLRKHQHQKYHHLLNDIWPFILEQRHQLPICEKWRTLPETALMERLKQTLKDYSDRFVCGREFKRAPAFYALRHSGPPHIPKVFLEPHEELSDELLEKRFKLMLMPEEPDEGANELPKRVPKDVYEFNTDEDDPVETSEDEIPIKQIIEKAKKQAAQKADKHDELPLKPDLADDNANDGDPGKLPAPIPPLLDANSSRKRKAFRLSKRYDNSRNHCDLSSDENSSSSRGTSSLDLIIPPPVNFLGRNNPFLMATPKKASQGRSISVGTGVGVNGIINSIFKLKGTSKEQPRMVRTIKRRLSAKDITIGPNQEVRRRRTRRLTTAIEVISTTTINPIPSHYLPIYAKDLQPPAPPMGKPTHGRLLRQRPQKQSPSQSRRNSTSSTATSSSSNGIGAPGHSMLDLKQSVNKYFGGAMNRIDAGEPFAIRAKRRMGNGQVQYLVEWGGDTATTAIGLLGN esc_drome Polycomb protein esc esc CG14941 Protein extra sex combs protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSSDKVKNGNEPEESEESCGDESASYTTNSTTSRSKSPSSSTRSKRRGRRSTKSKPKSRAAYKYDTHVKENHGANIFGVAFNTLLGKDEPQVFATAGSNRVTVYECPRQGGMQLLHCYADPDPDEVFYTCAWSYDLKTSSPLLAAAGYRGVIRVIDVEQNEAVGNYIGHGQAINELKFHPHKLQLLLSGSKDHAIRLWNIQSHVCIAILGGVEGHRDEVLSIDFNMRGDRIVSSGMDHSLKLWCLNTPEFHHKIELSNTFSQEKSTLPFPTVTKHFPDFSTRDIHRNYVDCVQWFGNFVLSKSCENAIVCWKPGQLHQSFEQVKPSDSSCTIIAEFEYDECEIWFVRFGFNPWQKVIALGNQQGKVYVWELDPSDPEGAHMTTLHNSRSVATVRQIAFSRDASVLVYVCDDATVWRWNRRQTTSI ez_drome Histone-lysine N-methyltransferase E(z) KMT6 E(z) CG6502 Protein enhancer of zeste Lysine N-methyltransferase 6 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNSTKVPPEWKRRVKSEYIKIRQQKRYKRADEIKEAWIRNWDEHNHNVQDLYCESKVWQAKPYDPPHVDCVKRAEVTSYNGIPSGPQKVPICVINAVTPIPTMYTWAPTQQNFMVEDETVLHNIPYMGDEVLDKDGKFIEELIKNYDGKVHGDKDPSFMDDAIFVELVHALMRSYSKELEEAAPGTATAIKTETLAKSKQGEDDGVVDVDADGESPMKLEKTDSKGDLTEVEKKETEEPLETEDADVKPDVEEVKDKLPFPAPIIFQAISANFPDKGTAQELKEKYIELTEHQDPERPQECTPNIDGIKAESVSRERTMHSFHTLFCRRCFKYDCFLHRLQGHAGPNLQKRRYPELKPFAEPCSNSCYMLIDGMKEKLAADSKTPPIDSCNEASSEDSNDSNSQFSNKDFNHENSKDNGLTVNSAAVAEINSIMAGMMNITSTQCVWTGADQALYRVLHKVYLKNYCAIAHNMLTKTCRQVYEFAQKEDAEFSFEDLRQDFTPPRKKKKKQRLWSLHCRKIQLKKDSSSNHVYNYTPCDHPGHPCDMNCSCIQTQNFCEKFCNCSSDCQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCQACGADQFKLTKITCKNVCVQRGLHKHLLMAPSDIAGWGIFLKEGAQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSINPNCYAKVMMVTGDHRIGIFAKRAIQPGEELFFDYRYGPTEQLKFVGIEREMEIV suz12_drome Polycomb protein Su(z)12 Su(z)12 CG8013 Suppressor 12 of zeste protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAPAKKREKDSNPDGSAANGIIGLTHGAPDASNAGSTVPPTAEGQVKLNGHQQEQELFLQAFEKPTQIYRYLRNRHETNPIFLNRTLSYMKERMSRNNKKRISFQVNSMLESITQKSEAVSQNYLHVIYDSLHEKLPARLDNESGEDLLQEQLLCEAGESVSVETTLYKITRSKRKDSTLDFQELLSKCSQIVYNPKDRVGEHATISIPLQTMRPMGEQHTLYKLLFRIKVLSPSTCNDENAETPPNKRSRPNEKMFGSELILYEKSSGFITEGEYEAMLQPLNSTSIKSFSPKKCTWETMPDSYIPLSLTYDVYQQSPMLKFHLTLSNEQLPEMISAPELQRYVQHLDAVAEMNYNNNNYNNNNNCSGLKNGSGGGNSTVCKTTPEHIQIVYNFMYSNNTRQQTEYTQELNCPWCGLDCLRLYALLKHLKLCHARFNFTYQPAGSGARIDVTINDAYDGSYAGSPYDLAGPSGSSFARTCGPVRRTSVTSLMVCRPRRQKTCLDEFLELDEDEISNQRSYITGHNRLYHHTETCLPVHPKELDIDSEGESDPLWLRQKTIQMIDEFSDVNEGEKELMKLWNLHVMRHGFVGDCQLPIACEMFLDAKGTEIVRKNLYRNFILHMCSLFDYGLIAAETVYKTVQKLQGLLSKYAAGQELMQRQREEQLKYWLDVGMHKKQEDPKTLKSPQKPAPPADQASTSSASTSGSGSGSSSMQPPKRMPAHLKRGSAASSPGVQSKGTENGTNGSNSSSSNSKNVAKKSADQPLSTLANTRERRSEYGQKRNVSGSRLAATPASKRKLSSKDNTVLNKRQRYSDGSPGTGIGNGHGGGSGSGANRNKSNNHSLPATSNNASSSSSNSKRAIARRRSTSERTKASGSTGGGAGGVRTRLSVPAKYERR caf1_drome Chromatin assembly factor 1 p55 subunit Caf1-55 CAF-1 Caf1 Nucleosome-remodeling factor 55 kDa subunit CG4236 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVDRSDNAAESFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDAQFDGSHYDNEKGEFGGFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPEIPASELETNTA rpd3-pcl Direct interaction detected by GST pull down. 178027 N/A 178033 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 178034 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false rpd3-esc Direct interaction detected by GST pull down. 178027 N/A 178035 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 178033 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false rpd3-e_z_ Direct interaction detected by GST pull down. 178027 N/A 178033 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 178036 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false rpd3-pcl-1 Direct interaction detected by GST pull down. 178027 N/A 178034 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phd finger binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 178033 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false rpd3-pcl-2 Direct interaction detected by GST pull down. 178027 N/A 178034 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 178033 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false e_z_-pcl Direct interaction detected by GST pull down. 178027 N/A 178036 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 178034 unspecified role unspecified role prey prey s35 radiolabel radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phd finger binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false pcl-esc Interaction detected by CoIP. 178028 N/A 178034 unspecified role unspecified role bait bait N/A 178037 unspecified role unspecified role prey prey N/A 178033 unspecified role unspecified role prey prey N/A 178036 unspecified role unspecified role prey prey association association false false false pcl-esc-1 Interaction detected by CoIP. 178028 N/A 178037 unspecified role unspecified role prey prey N/A 178035 unspecified role unspecified role bait bait N/A 178034 unspecified role unspecified role prey prey N/A 178033 unspecified role unspecified role prey prey N/A 178036 unspecified role unspecified role prey prey association association false false false pcl-esc-2 Interaction detected by CoIP. 178028 N/A 178036 unspecified role unspecified role bait bait N/A 178034 unspecified role unspecified role prey prey N/A 178037 unspecified role unspecified role prey prey N/A 178033 unspecified role unspecified role prey prey association association false false false pcl-esc-3 Interaction detected by affinity chromatography. 178029 N/A 178036 unspecified role unspecified role prey prey N/A 178038 unspecified role unspecified role prey prey N/A 178035 unspecified role unspecified role prey prey N/A 178034 unspecified role unspecified role bait bait association association false false false pcl-esc-4 Interaction detected by GST-pull down. 178030 N/A 178038 unspecified role unspecified role prey prey N/A 178033 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 178035 unspecified role unspecified role prey prey N/A 178034 unspecified role unspecified role prey prey N/A 178036 unspecified role unspecified role prey prey association association false false false pcl-esc-5 Interaction detected by fractionation on Superose column. 178031 N/A 178037 unspecified role unspecified role neutral component neutral component N/A 178034 unspecified role unspecified role neutral component neutral component N/A 178038 unspecified role unspecified role neutral component neutral component N/A 178035 unspecified role unspecified role neutral component neutral component N/A 178033 unspecified role unspecified role neutral component neutral component N/A 178036 unspecified role unspecified role neutral component neutral component physical association physical association false false false Ethidium bromide treated fractions from the column were further subject to co-IP using anti Esc, anti SU(Z)12 and anti PCL antibodies to emphasise the complex of the above proteins. The compelx is ~ 670 kDa in size rpd3-pcl-3 Colocalization by immunostaining. 178032 N/A 178033 unspecified role unspecified role neutral component neutral component N/A 178036 unspecified role unspecified role neutral component neutral component N/A 178034 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false