IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ faucheux-2003-2 batman Interacts with polycomb and trithorax group genes and encodes a BTB/POZ protein that is included in a complex containing GAGA factor. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Faucheux M., Roignant JY., Netter S., Charollais J., Antoniewski C., Theodore L. Chromatin - Epigenetic interactions resulting in chromatin modulation Mol. Cell. Biol. (0270-7306) 2003 faucheux-2003-1 batman Interacts with polycomb and trithorax group genes and encodes a BTB/POZ protein that is included in a complex containing GAGA factor. drome Drosophila melanogaster (Fruit fly) Fruit fly coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Faucheux M., Roignant JY., Netter S., Charollais J., Antoniewski C., Theodore L. Chromatin - Epigenetic interactions resulting in chromatin modulation Mol. Cell. Biol. (0270-7306) 2003 lolal_drome Longitudinals lacking protein-like lolal ban Protein Batman CG5738 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MMSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPSSIKREG gaga_drome Transcription factor GAGA Trl GAGA TFGAGA Trithorax-like protein GAGA factor Adh transcription factor 2 Neural conserved at 70F Adf-2 Nc70F CG33261 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSLPMNSLYSLTWGDYGTSLVSAIQLLRCHGDLVDCTLAAGGRSFPAHKIVLCAASPFLLDLLKNTPCKHPVVMLAGVNANDLEALLEFVYRGEVSVDHAQLPSLLQAAQCLNIQGLAPQTVTKDDYTTHSIQLQHMIPQHHDQDQLIATIATAPQQTVHAQVVEDIHHQGQILQATTQTNAAGQQQTIVTTDAAKHDQAVIQAFLPARKRKPRVKKMSPTAPKISKVEGMDTIMGTPTSSHGSGSVQQVLGENGAEGQLLSSTPIIKSEGQKVETIVTMDPNNMIPVTSANAATGEITPAQGATGSSGGNTSGVLSTPKAKRAKHPPGTEKPRSRSQSEQPATCPICYAVIRQSRNLRRHLELRHFAKPGVKKEKKTTSGKKSSSGSSGSGSGALSSSGSVPQVQTVQSLHTLQGVQVKKDPDAQQQQQQQQQQQQQQQQAMTVSGATGGQVQQQVQQVQQQVQQQQQQQQQQQQQLQHHQIIDSSGNITTATTSAQAAAAAQQQAAGQQQQLVAQSDGSESGAPLSIAQVQTLQGHQIIGNLNQVNMTDFQQQQPQQQQQQQQQQQQQQQQQQQTQQTL lolal-lolal-1 Interaction detected by Y2D 103407 n/a 103409 unspecified role unspecified role prey prey n/a 103409 unspecified role unspecified role bait bait physical association physical association false false false trl-lolal-5 Interaction detected by Y2D 103407 n/a 103409 unspecified role unspecified role bait bait N/A 103410 unspecified role unspecified role prey prey physical association physical association false false false lolal-trl-4 Interaction detected by coIP 103408 N/A 103410 unspecified role unspecified role prey prey n/a 103409 unspecified role unspecified role bait bait physical association physical association false false false