IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wang-2002e-2 Drosophila Enhancer of zeste protein interacts with dSAP18. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wang L., Ding L., Jones CA., Jones RS. Chromatin - Epigenetic interactions resulting in chromatin modulation rjones@mail.smu.edu Gene (0378-1119) 2002 Only protein-protein interactions imex curation Leucine prototrophy and expression of beta-galactosidase used to detect interaction. 0�12 h embryo Drosophila cDNA library wang-2002e-3 Drosophila Enhancer of zeste protein interacts with dSAP18. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Wang L., Ding L., Jones CA., Jones RS. Chromatin - Epigenetic interactions resulting in chromatin modulation rjones@mail.smu.edu Gene (0378-1119) 2002 Only protein-protein interactions imex curation Leucine prototrophy and expression of beta-galactosidase used to detect interaction. 0�12 h embryo Drosophila cDNA library wang-2002e-1 Drosophila Enhancer of zeste protein interacts with dSAP18. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wang L., Ding L., Jones CA., Jones RS. Chromatin - Epigenetic interactions resulting in chromatin modulation Leucine prototrophy and expression of beta-galactosidase used to detect interaction. rjones@mail.smu.edu 0�12 h embryo Drosophila cDNA library Gene (0378-1119) 2002 Only protein-protein interactions imex curation wang-2002e-4 Drosophila Enhancer of zeste protein interacts with dSAP18. drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang L., Ding L., Jones CA., Jones RS. Chromatin - Epigenetic interactions resulting in chromatin modulation rjones@mail.smu.edu Gene (0378-1119) 2002 Only protein-protein interactions imex curation Leucine prototrophy and expression of beta-galactosidase used to detect interaction. 0�12 h embryo Drosophila cDNA library wang-2002e-5 Drosophila Enhancer of zeste protein interacts with dSAP18. drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Wang L., Ding L., Jones CA., Jones RS. Chromatin - Epigenetic interactions resulting in chromatin modulation rjones@mail.smu.edu Gene (0378-1119) 2002 Only protein-protein interactions imex curation Leucine prototrophy and expression of beta-galactosidase used to detect interaction. 0�12 h embryo Drosophila cDNA library wang-2002e-6 Drosophila Enhancer of zeste protein interacts with dSAP18. drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang L., Ding L., Jones CA., Jones RS. Chromatin - Epigenetic interactions resulting in chromatin modulation rjones@mail.smu.edu Gene (0378-1119) 2002 Only protein-protein interactions imex curation Leucine prototrophy and expression of beta-galactosidase used to detect interaction. 0�12 h embryo Drosophila cDNA library wang-2002e-7 Drosophila Enhancer of zeste protein interacts with dSAP18. drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Wang L., Ding L., Jones CA., Jones RS. Chromatin - Epigenetic interactions resulting in chromatin modulation Nuclear extracts were prepared from 0 to 24 h HA-esc embryos and passed over a Superose 6 column. rjones@mail.smu.edu Gene (0378-1119) 2002 Only protein-protein interactions imex curation Leucine prototrophy and expression of beta-galactosidase used to detect interaction. 0�12 h embryo Drosophila cDNA library sap18_drome Histone deacetylase complex subunit SAP18 Bin1 SAP18 CG6046 18 kDa Sin3-associated polypeptide Bicoid-interacting protein 1 dSAP18 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MANVESMIVEEKTQVKQIDREKTCPMLLRVFCSTGRHHSVSEYMFGNVPTNELQIYTWQDATLHELTSLVRDVNPDTRKKGTYFDFAVVYPNFRSNHFQMREIGVTCTGQKGIDDNKTLAQAKFSIGDFLDISITPPNRLPPTARRQRPY ez_drome Histone-lysine N-methyltransferase E(z) KMT6 E(z) CG6502 Protein enhancer of zeste Lysine N-methyltransferase 6 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNSTKVPPEWKRRVKSEYIKIRQQKRYKRADEIKEAWIRNWDEHNHNVQDLYCESKVWQAKPYDPPHVDCVKRAEVTSYNGIPSGPQKVPICVINAVTPIPTMYTWAPTQQNFMVEDETVLHNIPYMGDEVLDKDGKFIEELIKNYDGKVHGDKDPSFMDDAIFVELVHALMRSYSKELEEAAPGTATAIKTETLAKSKQGEDDGVVDVDADGESPMKLEKTDSKGDLTEVEKKETEEPLETEDADVKPDVEEVKDKLPFPAPIIFQAISANFPDKGTAQELKEKYIELTEHQDPERPQECTPNIDGIKAESVSRERTMHSFHTLFCRRCFKYDCFLHRLQGHAGPNLQKRRYPELKPFAEPCSNSCYMLIDGMKEKLAADSKTPPIDSCNEASSEDSNDSNSQFSNKDFNHENSKDNGLTVNSAAVAEINSIMAGMMNITSTQCVWTGADQALYRVLHKVYLKNYCAIAHNMLTKTCRQVYEFAQKEDAEFSFEDLRQDFTPPRKKKKKQRLWSLHCRKIQLKKDSSSNHVYNYTPCDHPGHPCDMNCSCIQTQNFCEKFCNCSSDCQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCQACGADQFKLTKITCKNVCVQRGLHKHLLMAPSDIAGWGIFLKEGAQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSINPNCYAKVMMVTGDHRIGIFAKRAIQPGEELFFDYRYGPTEQLKFVGIEREMEIV esc_drome Polycomb protein esc esc CG14941 Protein extra sex combs protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSSDKVKNGNEPEESEESCGDESASYTTNSTTSRSKSPSSSTRSKRRGRRSTKSKPKSRAAYKYDTHVKENHGANIFGVAFNTLLGKDEPQVFATAGSNRVTVYECPRQGGMQLLHCYADPDPDEVFYTCAWSYDLKTSSPLLAAAGYRGVIRVIDVEQNEAVGNYIGHGQAINELKFHPHKLQLLLSGSKDHAIRLWNIQSHVCIAILGGVEGHRDEVLSIDFNMRGDRIVSSGMDHSLKLWCLNTPEFHHKIELSNTFSQEKSTLPFPTVTKHFPDFSTRDIHRNYVDCVQWFGNFVLSKSCENAIVCWKPGQLHQSFEQVKPSDSSCTIIAEFEYDECEIWFVRFGFNPWQKVIALGNQQGKVYVWELDPSDPEGAHMTTLHNSRSVATVRQIAFSRDASVLVYVCDDATVWRWNRRQTTSI bin1-bin1 594246 N/A 594253 unspecified role unspecified role bait bait N/A 594253 unspecified role unspecified role prey prey physical association physical association false false false 1B bin1-e_z_-1 594246 N/A 594253 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 594254 unspecified role unspecified role bait bait set domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1A bin1-e_z_-2 594247 N/A 594254 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 594253 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2A bin1-e_z_-3 594247 N/A 594254 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cxc region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 594253 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false 2B, C, D bin1-e_z_ 594248 N/A 594254 unspecified role unspecified role bait bait set domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 594253 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false bin1-e_z_-4 594249 N/A 594254 unspecified role unspecified role bait bait N/A 594253 unspecified role unspecified role prey prey physical association physical association false false false 3A Interaction was detected in HA-esc embryos. bin1-e_z_-5 594250 N/A 594253 unspecified role unspecified role bait bait N/A 594254 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3B bin1-esc 594251 N/A 594253 unspecified role unspecified role prey prey N/A 594255 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3C bin1-e_z_-6 594252 N/A 594254 unspecified role unspecified role neutral component neutral component N/A 594253 unspecified role unspecified role neutral component neutral component physical association physical association false false false 4 dSAP18-containing complexes range in mass from 1100 to 450 kDa.