UniProt UniProt http://www.uniprot.org arevalo_rod-2000-1 Cyclophilin A and Ess1 interact with and regulate silencing by the Sin3-Rpd3 histone deacetylase. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Arevalo-Rodriguez M., Cardenas ME., Wu X., Hanes SD., Heitman J. Chromatin - Epigenetic interactions resulting in chromatin modulation heitm001@duke.edu EMBO J. 19 (3739-3749) 2000 Only protein-protein interactions imex curation arevalo_rod-2000-2 Cyclophilin A and Ess1 interact with and regulate silencing by the Sin3-Rpd3 histone deacetylase. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Arevalo-Rodriguez M., Cardenas ME., Wu X., Hanes SD., Heitman J. Chromatin - Epigenetic interactions resulting in chromatin modulation heitm001@duke.edu EMBO J. 19 (3739-3749) 2000 Only protein-protein interactions imex curation rpd3_yeast Histone deacetylase RPD3 RPD3 SDI2 YNL330C N0305 MOF6 REC3 SDS6 Transcriptional regulatory protein RPD3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVYEATPFDPITVKPSDKRRVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKCDVAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDIGVGAGKNYAVNVPLRDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVNYVKSFGIPMMVVGGGGYTMRNVARTWCFETGLLNNVVLDKDLPYNEYYEYYGPDYKLSVRPSNMFNVNTPEYLDKVMTNIFANLENTKYAPSVQLNHTPRDAEDLGDVEEDSAEAKDTKGGSQYARDLHVEHDNEFY 34FFD72A7E7425DB cyph_yeast Peptidyl-prolyl cis-trans isomerase CPR1 CPH1 SCC1 YDR155C YD8358.10C CYP1 Cyclophilin Cyclosporin A-binding protein PPI-II Rotamase protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLGSPSGATKARIVVAKSGEL 012D8E8E4D85B4B7 ess1_yeast Peptidyl-prolyl cis-trans isomerase ESS1 Processing/termination factor 1 ESS1 PIN1 PTF1 J1452 YJR017C Parvulin ESS1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPSDVASRTGLPTPWTVRYSKSKKREYFFNPETKHSQWEEPEGTNKDQLHKHLRDHPVRVRCLHILIKHKDSRRPASHRSENITISKQDATDELKTLITRLDDDSKTNSFEALAKERSDCSSYKRGGDLGWFGRGEMQPSFEDAAFQLKVGEVSDIVESGSGVHVIKRVG 18D3EC02E8395175 sap30_yeast Transcriptional regulatory protein SAP30 YM8156.05 YMR263W SAP30 protein protein yeast Saccharomyces cerevisiae Baker's yeast MARPVNTNAETESRGRPTQGGGYASNNNGSCNNNNGSNNNNNNNNNNNNNSNNSNNNNGPTSSGRTNGKQRLTAAQQQYIKNLIETHITDNHPDLRPKSHPMDFEEYTDAFLRRYKDHFQLDVPDNLTLQGYLLGSKLGAKTYSYKRNTQGQHDKRIHKRDLANVVRRHFDEHSIKETDCIPQFIYKVKNQKKKFKMEFRG cpr1-rpd3 741144 N/A 741146 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 741147 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 5 ess1-rpd3 741144 N/A 741148 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 741146 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Fig. 5 This interaction requires the presence of SIN3. cpr1-sap30 741145 N/A 741149 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 741147 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 5 This interaction requires the presence of RPD3. ess1-sap30 741145 N/A 741149 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 741148 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 5 This interaction requires the presence of SIN3 and RPD3.