IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ng-2000-1 A Drosophila ESC-E(Z) protein complex is distinct from other polycomb group complexes and contains covalently modified ESC. drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Ng J., Hart CM., Morgan K., Simon JA. Chromatin - Epigenetic interactions resulting in chromatin modulation Nuclear extracts from 0- to 24-h-old HA-esc embryos were fractionated by size exclusion chromatography on a Superose 6 column. Mol. Cell. Biol. (0270-7306) 2000 Only protein-protein interactions imex curation ng-2000-2 A Drosophila ESC-E(Z) protein complex is distinct from other polycomb group complexes and contains covalently modified ESC. drome-embryo drosophilla melanogaster embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ng J., Hart CM., Morgan K., Simon JA. Chromatin - Epigenetic interactions resulting in chromatin modulation Nuclear extracts from 0- to 24-h-old HA-esc embryos were used. Mol. Cell. Biol. (0270-7306) 2000 Only protein-protein interactions imex curation Nuclear extracts from 0- to 24-h-old HA-esc embryos were fractionated by size exclusion chromatography on a Superose 6 column. ez_drome Histone-lysine N-methyltransferase E(z) KMT6 E(z) CG6502 Protein enhancer of zeste Lysine N-methyltransferase 6 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNSTKVPPEWKRRVKSEYIKIRQQKRYKRADEIKEAWIRNWDEHNHNVQDLYCESKVWQAKPYDPPHVDCVKRAEVTSYNGIPSGPQKVPICVINAVTPIPTMYTWAPTQQNFMVEDETVLHNIPYMGDEVLDKDGKFIEELIKNYDGKVHGDKDPSFMDDAIFVELVHALMRSYSKELEEAAPGTATAIKTETLAKSKQGEDDGVVDVDADGESPMKLEKTDSKGDLTEVEKKETEEPLETEDADVKPDVEEVKDKLPFPAPIIFQAISANFPDKGTAQELKEKYIELTEHQDPERPQECTPNIDGIKAESVSRERTMHSFHTLFCRRCFKYDCFLHRLQGHAGPNLQKRRYPELKPFAEPCSNSCYMLIDGMKEKLAADSKTPPIDSCNEASSEDSNDSNSQFSNKDFNHENSKDNGLTVNSAAVAEINSIMAGMMNITSTQCVWTGADQALYRVLHKVYLKNYCAIAHNMLTKTCRQVYEFAQKEDAEFSFEDLRQDFTPPRKKKKKQRLWSLHCRKIQLKKDSSSNHVYNYTPCDHPGHPCDMNCSCIQTQNFCEKFCNCSSDCQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCQACGADQFKLTKITCKNVCVQRGLHKHLLMAPSDIAGWGIFLKEGAQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSINPNCYAKVMMVTGDHRIGIFAKRAIQPGEELFFDYRYGPTEQLKFVGIEREMEIV esc_drome Polycomb protein esc esc CG14941 Protein extra sex combs protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSSDKVKNGNEPEESEESCGDESASYTTNSTTSRSKSPSSSTRSKRRGRRSTKSKPKSRAAYKYDTHVKENHGANIFGVAFNTLLGKDEPQVFATAGSNRVTVYECPRQGGMQLLHCYADPDPDEVFYTCAWSYDLKTSSPLLAAAGYRGVIRVIDVEQNEAVGNYIGHGQAINELKFHPHKLQLLLSGSKDHAIRLWNIQSHVCIAILGGVEGHRDEVLSIDFNMRGDRIVSSGMDHSLKLWCLNTPEFHHKIELSNTFSQEKSTLPFPTVTKHFPDFSTRDIHRNYVDCVQWFGNFVLSKSCENAIVCWKPGQLHQSFEQVKPSDSSCTIIAEFEYDECEIWFVRFGFNPWQKVIALGNQQGKVYVWELDPSDPEGAHMTTLHNSRSVATVRQIAFSRDASVLVYVCDDATVWRWNRRQTTSI e_z_-esc-1 594369 N/A 594371 unspecified role unspecified role neutral component neutral component N/A 594372 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2 HA-ESC and E(Z) cofractionate in complexes of about 600 kDa e_z_-esc-2 594370 N/A 594372 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 594371 unspecified role unspecified role prey prey physical association physical association false false false 3