bhf-ucl soos-1993-1 Purified hybrid insulin/insulin-like growth factor-I receptors bind insulin-like growth factor-I, but not insulin, with high affinity. in vitro In vitro competition binding competition binding tag visualisation tag visualisation Soos M.A., Field C.E., Siddle K. Cardiac - Interactions involving cardiac related proteins Purified Receptors were obtained by immunodepletion followed by receptor specific immunoprecipitation. Results obtained using receptor hybrids have not been entered as the exact identity of the molecules involved is not known ks14@mole.bio.cam.ac.uk Biochem. J. (0264-6021) 1993 Only protein-protein interactions imex curation soos-1993-2 Purified hybrid insulin/insulin-like growth factor-I receptors bind insulin-like growth factor-I, but not insulin, with high affinity. in vitro In vitro affinity techniques affinity technology affinity techniques tag visualisation tag visualisation Soos M.A., Field C.E., Siddle K. Cardiac - Interactions involving cardiac related proteins Purified Receptors were obtained by immunodepletion followed by receptor specific immunoprecipitation. Results obtained using receptor hybrids have not been entered as the exact identity of the molecules involved is not known ks14@mole.bio.cam.ac.uk Biochem. J. (0264-6021) 1993 Only protein-protein interactions imex curation igf1_human Insulin-like growth factor I IGF1 IBP1 Somatomedin-C Mechano growth factor protein protein human Homo sapiens Human MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity Defects in IGF1 are the cause of insulin-like growth factor I deficiency (IGF1 deficiency) [MIM:608747]. IGF1 deficiency is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness and mental retardation mint igf1r_human Insulin-like growth factor 1 receptor Insulin-like growth factor I receptor IGF1R protein protein human Homo sapiens Human MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC ins_bovin Insulin INS protein protein bovin Bos taurus (Bovine) Bovine MALWTRLRPLLALLALWPPPPARAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEGPQVGALELAGGPGAGGLEGPPQKRGIVEQCCASVCSLYQLENYCN insr_human Insulin receptor INSR protein protein human Homo sapiens Human MATGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQGCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDVGNVTVAVPTVAAFPNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSNPS igf1r-igf1-3 1477745 n/a 1477747 unspecified role unspecified role prey prey 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1477748 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta physical association physical association false false false Fig.2 A/C igf1r-igf1-3 1477745 n/a 1477747 unspecified role unspecified role prey prey i125 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1477747 competitor competitor competitor unspecified role unspecified role n/a 1477748 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta physical association physical association false false false 1477745 Fig.2 A, Table 4 igf1r-igf1-3 1477745 n/a 1477747 unspecified role unspecified role prey prey i125 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1477749 competitor competitor competitor unspecified role unspecified role n/a 1477748 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta physical association physical association false false false 1477745 Fig.2 C, Table 4 insr-igf1 1477745 n/a 1477747 unspecified role unspecified role prey prey 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1477750 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta physical association physical association false false false Fig.2 A/C insr-igf1-1 1477745 n/a 1477747 unspecified role unspecified role prey prey 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1477750 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta n/a 1477749 competitor competitor competitor unspecified role unspecified role physical association physical association false false false 1477745 Fig.2 C, Table 4 insr-igf1-2 1477745 n/a 1477747 unspecified role unspecified role prey prey 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1477747 competitor competitor competitor unspecified role unspecified role n/a 1477750 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta physical association physical association false false false 1477745 Fig.2 A, Table 4 insr-ins-2 1477745 n/a 1477750 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta n/a 1477749 unspecified role unspecified role prey prey 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig.2 B/D insr-ins-2 1477745 n/a 1477750 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta n/a 1477749 competitor competitor competitor unspecified role unspecified role n/a 1477749 unspecified role unspecified role prey prey 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1477745 Fig.2 B, Table 4 insr-ins-2 1477745 n/a 1477747 competitor competitor competitor unspecified role unspecified role n/a 1477749 unspecified role unspecified role prey prey 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1477750 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta physical association physical association false false false 1477745 Fig.2D , Table 4 igf1r-ins 1477745 n/a 1477748 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta n/a 1477749 unspecified role unspecified role prey prey 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig.2 B/D igf1r-ins-2 1477745 n/a 1477749 competitor competitor competitor unspecified role unspecified role n/a 1477748 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta n/a 1477749 unspecified role unspecified role prey prey 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1477745 Fig.2 B, Table 4 igf1r-ins-4 1477745 n/a 1477747 competitor competitor competitor unspecified role unspecified role n/a 1477748 unspecified role unspecified role bait bait human-placenta Homo sapiens placenta placenta n/a 1477749 unspecified role unspecified role prey prey 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1477745 Fig.2D , Table 4 ins-insr 1477746 n/a 1477749 unspecified role unspecified role unspecified role unspecified role 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1477750 unspecified role unspecified role unspecified role unspecified role human-placenta Homo sapiens placenta placenta physical association physical association false false false Table 5 DTT -Dithiothreitol igf1-igf1r-1 1477746 n/a 1477747 unspecified role unspecified role unspecified role unspecified role 125i 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1477748 unspecified role unspecified role unspecified role unspecified role human-placenta Homo sapiens placenta placenta physical association physical association false false false Table 5 DTT -Dithiothreitol had little effect on binding.