IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ youcef-2015-1 rat-h9c2 h9c2 rat myoblasts h9c2 h9c2 rat myoblasts pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Youcef G., Belaidi E., Waeckel L., Fazal L., Clemessy M., Vincent MP., Zadigue G., Richer C., Alhenc-Gelas F., Ovize M., Pizard A. Cardiac - Interactions involving cardiac related proteins The molecule "VDAC" was determined to be VDAC1 from the antibody suppliers site. anne.pizard@inserm.fr Biochemical pharmacology 2015 Only protein-protein interactions imex curation imex curation Affinomics - Interactions curated for the Affinomics consortium. vdac1_rat Voltage-dependent anion-selective channel protein 1 Vdac1 Outer mitochondrial membrane protein porin 1 protein protein rat Rattus norvegicus (Rat) Rat MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVNGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDVDFDIAGPSIRGALVLGYEGWLAGYQMNFETSKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQVDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA klk1_rat Kallikrein-1 Gamma-NGF Nerve growth factor gamma chain PS kallikrein Pancreatic kallikrein RGK-1 Tissue kallikrein True tissue kallikrein Ngfg Klk-1 Klk1 protein protein rat Rattus norvegicus (Rat) Rat MWFLILFLALSLGRNDAAPPVQSRVVGGYNCEMNSQPWQVAVYYFGEYLCGGVLIDPSWVITAAHCATDNYQVWLGRNNLYEDEPFAQHRLVSQSFPHPGFNQDLIWNHTRQPGDDYSNDLMLLHLSQPADITDGVKVIDLPIEEPKVGSTCLASGWGSITPDGLELSDDLQCVNIDLLSNEKCVEAHKEEVTDLMLCAGEMDGGKDTCKGDSGGPLICNGVLQGITSWGFNPCGEPKKPGIYTKLIKFTPWIKEVMKENP tom22_rat Mitochondrial import receptor subunit TOM22 homolog Tomm22 Translocase of outer membrane 22 kDa subunit homolog Tom22 protein protein rat Rattus norvegicus (Rat) Rat MAAAVAAAGAGEPLSPEELVPKAEAEKAEEDLEEDDDDELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPPLPGKI ppif_rat Peptidyl-prolyl cis-trans isomerase F, mitochondrial Cyclophilin D Ppif Cyclophilin F Rotamase F protein protein rat Rattus norvegicus (Rat) Rat MLALRCGPRLLGLLSGPRSAPLLLSTTRTCSDGGARGANSSSQNPLVYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGKTSKKIVITDCGQLS p08934-pro_0000006697 Bradykinin Kng1 Kng protein protein rat Rattus norvegicus (Rat) Rat RPPGFSPFR 381 389 kng1-vdac1-2 1790667 N/A 1790668 unspecified role unspecified role neutral component neutral component N/A 1790669 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 3B-1 kng1-tomm22-1 1790667 N/A 1790670 unspecified role unspecified role neutral component neutral component N/A 1790669 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 3B-2 ngfg-ppif-1 1790667 N/A 1790671 unspecified role unspecified role neutral component neutral component N/A 1790669 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 3B-3 kng1-ppif-1 1790667 N/A 1790671 unspecified role unspecified role neutral component neutral component N/A 1790672 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 3B-4