bhf-ucl stefanovic-2009-2 Interplay of Oct4 with Sox2 and Sox17: a molecular switch from stem cell pluripotency to specifying a cardiac fate. human-embryonic_stem_ cells Human-embryonic_stem_ cells (es cells) embryonic_stem_cell Embryonic stem cell (es cells) ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Stefanovic S., Abboud N., Désilets S., Nury D., Cowan C., Pucéat M. Cardiac - Interactions involving cardiac related proteins michel.puceat@inserm.fr J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation stefanovic-2009-1 Interplay of Oct4 with Sox2 and Sox17: a molecular switch from stem cell pluripotency to specifying a cardiac fate. mouse-end-2 mouse-END-2 visceral_endoderm Visceral Endoderm like cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Stefanovic S., Abboud N., Désilets S., Nury D., Cowan C., Pucéat M. Cardiac - Interactions involving cardiac related proteins Human Oct4-iA is over-expressed. If it is not over-expressed there is no binding. (The mouse Oct4-iA endogenous one is also present) END-2 cells: visceral-endoderm-like derivative of P19, an embryonic carcinoma cell line derived from an embryo-derived teratocarcinoma in mice. (ref. Mummery et al. 1991. PMID:1710586) michel.puceat@inserm.fr J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation stefanovic-2009-3 Interplay of Oct4 with Sox2 and Sox17: a molecular switch from stem cell pluripotency to specifying a cardiac fate. human-ips Human- induced pluripotent stem cells ips cells Induced pluripotent stem cells ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Stefanovic S., Abboud N., Désilets S., Nury D., Cowan C., Pucéat M. Cardiac - Interactions involving cardiac related proteins They use iPS Oct4-iA over expressing cells iPS cells used are human (confirmed by the author) michel.puceat@inserm.fr J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation stefanovic-2009-4 Interplay of Oct4 with Sox2 and Sox17: a molecular switch from stem cell pluripotency to specifying a cardiac fate. human-embryonic_stem_ cells Human-embryonic_stem_ cells (es cells) embryonic_stem_cell Embryonic stem cell (es cells) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Stefanovic S., Abboud N., Désilets S., Nury D., Cowan C., Pucéat M. Cardiac - Interactions involving cardiac related proteins michel.puceat@inserm.fr J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation po5f1_human POU domain, class 5, transcription factor 1 Octamer-binding transcription factor 3 Octamer-binding protein 3 POU5F1 OCT3 OCT4 OTF3 Octamer-binding protein 4 protein protein human Homo sapiens Human MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN sox2_human_gene Transcription factor SOX-2 gene gene gene human Homo sapiens Human sox17_human_gene Transcription factor SOX-17 SOX17 gene gene human Homo sapiens Human nkx25_human_gene Homeobox protein Nkx-2.5 NKX2-5 CSX NKX2.5 NKX2E Cardiac-specific homeobox Homeobox protein CSX Homeobox protein NK-2 homolog E gene gene human Homo sapiens Human smad4_human Mothers against decapentaplegic homolog 4 SMAD4 DPC4 MADH4 SMAD family member 4 Deletion target in pancreatic carcinoma 4 protein protein human Homo sapiens Human MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQIASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGHYWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD tbx6_human_gene T-box transcription factor TBX6 TBX6 gene gene human Homo sapiens Human q01860-1 POU domain, class 5, transcription factor 1 POU5F1 OCT3 OCT4 OTF3 Octamer-binding protein 3 Octamer-binding protein 4 Octamer-binding transcription factor 3 Oct-3A Oct3A protein protein human Homo sapiens Human MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN mint sox17_mouse Transcription factor SOX-17 Sox17 Sox-17 protein protein mouse Mus musculus Mouse MSSPDAGYASDDQSQPRSAQPAVMAGLGPCPWAESLSPLGDVKVKGEVVASSGAPAGTSGRAKAESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQHMQDHPNYKYRPRRRKQVKRMKRVEGGFLHALVEPQAGALGPEGGRVAMDGLGLPFPEPGYPAGPPLMSPHMGPHYRDCQGLGAPALDGYPLPTPDTSPLDGVEQDPAFFAAPLPGDCPAAGTYTYAPVSDYAVSVEPPAGPMRVGPDPSGPAMPGILAPPSALHLYYGAMGSPAASAGRGFHAQPQQPLQPQAPPPPPQQQHPAHGPGQPSPPPEALPCRDGTESNQPTELLGEVDRTEFEQYLPFVYKPEMGLPYQGHDCGVNLSDSHGAISSVVSDASSAVYYCNYPDI sox2_human Transcription factor SOX-2 SOX2 protein protein human Homo sapiens Human MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM pou5f1-sox2-4 1511586 n/a 1511590 unspecified role unspecified role bait bait n/a 1511591 unspecified role unspecified role prey prey distal enhancer binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2C, 3B, 4B Oct4-iA over-expression Conditioned medium from Oct4-iA over-expressing cells pou5f1-sox2-6 1511586 n/a 1511591 unspecified role unspecified role prey prey distal enhancer binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1511590 unspecified role unspecified role bait bait association association false false false Fig. 2A BMP2 pou5f1-sox17-4 1511586 n/a 1511592 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1511590 unspecified role unspecified role bait bait association association false false false Fig. 2D, H, 3B, 4B Oct4-iA over-expression Oct4-iA over-expression + Sox2 shRNA Conditioned medium of Oct4-iA over-expressing cells Oct4-iA over-expression + Sox2 Oct4-iA over-expression + Sox17 shRNA pou5f1-sox17-7 1511586 n/a 1511590 unspecified role unspecified role bait bait n/a 1511592 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2B BMP2 smad4-nkx2_5 1511586 n/a 1511593 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1511594 unspecified role unspecified role bait bait association association false false false Fig. S3A Oct 4-iA overexpression smad4-tbx6-1 1511586 n/a 1511595 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1511594 unspecified role unspecified role bait bait association association false false false Fig. S3A Oct 4-iA overexpression pou5f1-sox17-1 1511587 n/a 1511596 unspecified role unspecified role bait bait n/a 1511597 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2I pou5f1-sox17-5 1511588 n/a 1511590 unspecified role unspecified role bait bait n/a 1511592 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. S3E pou5f1-sox2-5 1511589 n/a 1511598 unspecified role unspecified role prey prey n/a 1511590 unspecified role unspecified role bait bait physical association physical association false false false Fig. 2F Oct4-iA over-expression significantly reduces the interaction