bhf-ucl wan-2009-3 OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. human-htc75 Homo sapiens htc75 htc75 bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins The construct pairs were analysed by flow cytometry. The source of YFP-tagged TPP1, OBFC1 and mutants is human as per author statement in text. songyang@bcm.edu J. Biol. Chem. (0021-9258) 2009 imex curation Only protein-protein interactions wan-2009-1 OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins Nuclear extracts were incubated with anti-mTPP1 antibodies, the proteins in the immunoprecipitates were resolved on SDS-PAGE, and stained with Coomassie Blue. The lanes were sectioned and excised for sequencing on a liquid chromatography tandem mass spectrometer. The source of the following proteins is mouse as they are endogenous to the mouse cell line used as per author statement: pot1, trf2, rap1, trf1, tpp1, tin2, obfc1. songyang@bcm.edu J. Biol. Chem. (0021-9258) 2009 imex curation Only protein-protein interactions wan-2009-2 OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip monoclonal western monoclonal antibody western blot monoclonal western Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins The source of the proteins OBFC1 and TPP1 is human as endogenous to HeLa cell line used or as per author statement. songyang@bcm.edu J. Biol. Chem. (0021-9258) 2009 imex curation Only protein-protein interactions wan-2009-4 OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins The source of YFP-tagged TPP1, OBFC1 and mutants is human as per author statement in text. songyang@bcm.edu J. Biol. Chem. (0021-9258) 2009 imex curation Only protein-protein interactions wan-2009-5 OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa autoradiography autoradiography Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins The source of GST-OBFC1 is human as per author statement in text. The sequence of the single stranded telomeric sequence TelG31 is human as per author statement in text. songyang@bcm.edu J. Biol. Chem. (0021-9258) 2009 imex curation Only protein-protein interactions wan-2009-6 OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins The source of bacterially expressed GST-OBFC1 is human as per author statement in text. RAP1 is human as it is endogenous to human cell line used U2OS. songyang@bcm.edu J. Biol. Chem. (0021-9258) 2009 imex curation Only protein-protein interactions wan-2009-7 OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. human-htc75 Homo sapiens htc75 htc75 fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins songyang@bcm.edu J. Biol. Chem. (0021-9258) 2009 imex curation Only protein-protein interactions wan-2009-8 OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins Anti-GST antibodies were added to the binding mixtures containing the highest concentration of GST-OBFC1 and ssDNA. The source of GST-OBFC1 is human as per author statement in text. The sequence of the single stranded telomeric sequence TelG31 is human as per author statement in text. songyang@bcm.edu J. Biol. Chem. (0021-9258) 2009 imex curation Only protein-protein interactions wan-2009-9 OB fold-containing protein 1 (OBFC1), a human homolog of yeast Stn1, associates with TPP1 and is implicated in telomere length regulation. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells anti bait coip anti bait coimmunoprecipitation anti bait coip monoclonal western monoclonal antibody western blot monoclonal western Wan M., Qin J., Songyang Z., Liu D. Cardiac - Interactions involving cardiac related proteins The source of the following proteins is mouse as they are endogenous to the mouse cell line used as per author statement: tpp1 and obfc1. songyang@bcm.edu J. Biol. Chem. (0021-9258) 2009 imex curation Only protein-protein interactions stn1_human CST complex subunit STN1 STN1 OBFC1 Oligonucleotide/oligosaccharide-binding fold-containing protein 1 Suppressor of cdc thirteen homolog protein protein human Homo sapiens Human MQPGSSRCEEETPSLLWGLDPVFLAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVLGTVIGVRERDAFYSYGVDDSTGVINCICWKKLNTESVSAAPSAARELSLTSQLKKLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHATTYYKVDDPVWNIQIARMLELPTIYRKVYDQPFHSSALEKEEALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFYQQELEMVESLLSLANQPVIHSASSDQVNFKKDTTSKAIHSIFKNAIQLLQEKGLVFQKDDGFDNLYYVTREDKDLHRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLELLEDQSDIVSTMEHYYTAF acd_human Adrenocortical dysplasia protein homolog POT1 and TIN2-interacting protein ACD PIP1 PTOP TINT1 TPP1 protein protein human Homo sapiens Human MAGSGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEHLSESTSSNAGLSLSQLLDEMREDQEHQGALVCLAESCLTLEGPCTAPPVTHWAASRCKATGEAVYTVPSSMLCISENDQLILSSLGPCQRTQGPELPPPDPALQDLSLTLIASPPSSPSSSGTPALPGHMSSEESGTSISLLPALSLAAPDPGQRSSSQPSPAICSAPATLTPRSPHASRTPSSPLQSCTPSLSPRSHVPSPHQALVTRPQKPSLEFKEFVGLPCKNRPPFPRTGATRGAQEPCSVWEPPKRHRDGSAFQYEYEPPCTSLCARVQAVRLPPQLMAWALHFLMDAQPGSEPTPM pote1_mouse Protection of telomeres protein 1 Pot1 Pot1a POT1-like telomere end-binding protein protein protein mouse Mus musculus Mouse MSLVSTAPYTYTPLNLLKEGTIANVYGVVKFFKPPYVSKGTDYCSVVTIVDQTNVKLTCMLFSGNYEALPIIYKVGDIVRFHRLKIQVYKNELQGINCSGFASLTFEGTVGMPVTARTSSKVFSFTPQDQKMVEALRVWASKHISASSTLVQLCDAQPMQYYDLTCQLLGKAQVDSTAFLLKVWDGTQTVLPSWRVSTQDLTFEGDLSHIERLQSLVVDILVYDNHVQVARSIEVGCFLRLYSLHTKLQPGNSETSSSESLRLEFHLHGGTSYGRGIRVLPDTSPCVDQLKKALEGANLPVTETSTGICQSENGDSSALSNSGSGAVSPYEEERCQQVSATILTNHQHLEKTPLCAILTQKAPQQYRVRAKLRSYLPRRLSQSVKLLCPKCHSVQEVPHGDSLDKILQDAATEAPDIKLKATSLYYSKVWTTEDQGGRQVAVHFVKNNGILPASSECLILIEGGRLCEVSKLSSKFHSVMPVRSGPESLELLTLSAPFLIQGKVHHYGCKQCSSLKPIQNLNSRFHKGPWTPSSVAEALGVVPLQYVFVMVFTLDDGTGVLEAYLKDSEHFFKIPASEVLTDDDLQRSLETIMDMICPPGIKVDAYPWLECLLKSYNVTIGTERRICYQIFDTTVAENVV mint Component of the telomerase ribonucleoprotein (RNP) complex that is essential for the replication of chromosome termini. Is a component of the double-stranded telomeric DNA-binding TRF1 complex which is involved in the regulation of telomere length by cis-inhibition of telomerase. Also acts as a single-stranded telomeric DNA-binding protein and thus may act as a downstream effector of the TRF1 complex and may transduce information about telomere maintenance and/or length to the telomere terminus. Binds to two or more telomeric single-stranded 5'-TTAGGG-3' repeats (G-strand) and with high specificity to a minimal telomeric single-stranded 5'-TAGGGTTAG-3' sequence. Binds telomeric single-stranded sequences internally or at proximity of a 3'-end. Its activity is TERT dependent but it does not increase TERT activity te2ip_mouse Telomeric repeat-binding factor 2-interacting protein 1 Terf2ip Rap1 Repressor/activator protein 1 homolog MNCb-0448 MNCb-0628 protein protein mouse Mus musculus Mouse MAEAMDLGKDPNGPTHSSTLFVREDGSAMSFYVRPSSAKRRLSTLILHGGGTVCRVQEPGAVLLAQPGEALAEASGDFISTQYILDCVDRNEKLDLEAYRLGLTEQASDPKPGASTEGSTEPEPQPLTGRIAYTDAEDVAILTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRGQEHKYLLGNAPVSPSSQKLKRKAEQDPEAADSGEPQNKRAPDLPEEECVKGEIKENGEADNKLFEEAAPEFGEAVVDESPDFEIHITMCDGDPPTPEEDSETQPDEEEEEPKVSTQEVGTAIKVIRQLMEKFNLDLSTVTQALLKNSGELEATSSFLESGRRPDGYPIWCRQDDLDLQKDDDDTKNALVKKFGAQNVARRIEFRKK mint May play a role in telomere length regulation tinf2_mouse TERF1-interacting nuclear factor 2 Tinf2 Tin2 TRF1-interacting nuclear protein 2 protein protein mouse Mus musculus Mouse MAPPPGVGPASLRFAAAASWLVVRRRRVEHFPKVVEFLQSLRAAAPGLVCYRHHERLCMSLKAKVVVELILQARPWDQVLNALKHHFPAESRTTKEDRKLLEARENFCLLVKHLSEDPPSSLQELEQDYGESFLVAMEKLLFEYLCQLEKALPPVRAQELQDALSWSQPGSFITSSVALHQYGMDMGWTFPESSTSGSGNLIEPMEESPHQQTRPAFHSPLPKAKLGPHQPASLEHPEHLAGHRFNLAPLGKRKSRSHWTSAKACHKERPTVMLLPFRNMGLPAQDLSNPKSREEPGAASAASVGTEPVCTEEAKTPSRPLGKRALEETPPDSPAASRRTV stn1_mouse CST complex subunit STN1 Stn1 Alpha-accessory factor of 44 kDa Obfc1 Oligonucleotide/oligosaccharide-binding fold-containing protein 1 Suppressor of cdc thirteen homolog protein protein mouse Mus musculus Mouse MPQPCLLMECESSPREEEIPPLFWGLDPVFLAFAKLYIKDILEMKESQQVPGTYFYNGHPIRRVDIMGAVISVKERETFYSYGVDDATGVINCVCWKKLSNAESSSDPAILSTARELSMTSQLKKLQETIEQKTRIGIGDIIRVRGSVRMFREEREICANIYYKVDDPVWNMQIARMLELPKLYQKVYDQPFRNPALQEEEALNNKDNLDLAGLTSLLSEKIKEFLQEKKMQSFYQQELETVESLQSLASRPVTHSTGSDQVELKDSGTSGVAQRVFKNALQLLQEKGLVFQRDSGSDKLYYVTTKDKDLQQKIYHIIKEDCQKPNHMEKGCHLLHILNCVHLNLRWDLSKAVLQRVLELLEDQSDIVSTADHYYAAF acd_mouse Adrenocortical dysplasia protein Acd protein protein mouse Mus musculus Mouse MSDSGLLALQPWIRELILGSETLSSPRTGQLLKVLQDSETPGPSSAPDTPDTGAVLLVSDGTHSVRCVVTRNAIDTSDWEEKELGFRGTEGRLLLLQACGLRVQVAQDHAPAEFYLQVDRFNLLPTEQPRIQVTGCNQDSDVQRKLNECLEDHLSESASSSAGLTLSQLLDEVREDQDHRGALVCLAKSCLVLKGPCTTTPLTDWITSGSQALGKAVFTVSGSLLHIPEGEEQILSSTGSSQKARGTSASPSHMPLEESGASVSLLSALATSDPGQMDSSQSPPAVGSTSPRAQAPTSPPCNSTPSSLLLNCSPSLSPLHPAPRSHQSCETRAQAPKLEFQCSFKKRQLLPRTSAQELCSVWEPPERHRDTSAFQYKYETPSASLHTQVQTARLSPQLVAWALNIVMESESELTQV terf2_mouse Telomeric repeat-binding factor 2 Terf2 Trf2 TTAGGG repeat-binding factor 2 Telomeric DNA-binding protein protein protein mouse Mus musculus Mouse MAAGAGTAGPASGPGVVRDPMASQPRKRPSREGGEGGEGERRSNTMAGGGGSSDSSGRAASRRASRSGGRARRGRHEPGLGGAAERGAGEARLEEAVNRWVLKFYFHEALRAFRSSRYRDFRQIRDIMQALLVRPLGKEHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTEFTLTDSMVESSRKLVKEAAVIICIKNKEFEKASKILKKYMSKDPTTQKLRTDLLNIIREKNLAHPVIQNFSYEVFQQKMLRFLESHLDDTEPYLLTMAKKALKSESAASSTMREEKHPEPVEKPLREPPSRQPQNPPATIGIRTLKAAFKALSTAQDSEAAFAKLDQKDLVLANLASPSSPAHKHKRPRKDEHESAAPAEGEGGSDRQPRNSPMTISRLLLEEDSQSTEPSPGLNSSHKAMSASKPRALNQPHPGEKKPKASKDKWNSPNGLEEKEVWLEEDQLFEVQAPGEDRSSSLTRKQKWTIEESEWVKDGVRKYGEGNWAAISKSYPFVNRTAVMIKDRWRTMKKLGMN terf1_mouse Telomeric repeat-binding factor 1 Terf1 Trf1 TTAGGG repeat-binding factor 1 protein protein mouse Mus musculus Mouse MAETVSSAARDAPSREGWTDSDSPEQEEVGDDAELLQCQLQLGTPREMENAELVAEVEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRDSAEAIIHGLHRLTAYQLKTVYICQFLTRVASGKALDAQFEVDERITPLESALMIWNSIEKEHDKLHDEIKNLIKIQAVAVCMEIGSFKEAEEVFERIFGDPEFYTPLERKLLKIISQKDVFHSLFQHFSYSCMMEKIQSYVGDVLSEKSSTFLMKAATKVVENEKARTQASKDRPDATNTGMDTEVGLNKEKSVNGQQSTETEPLVDTVSSIRSHKNALSQLKHRRAPSDFSRNEARTGTLQCETTMERNRRTSGRNRLCVSENQPDTDDKSGRRKRQTWLWEEDRILKCGVKKYGEGNWAKILSHYKFNNRTSVMLKDRWRTMKRLKLIS telg31 5-GTTAGGGTTAGGGTTAGGGTTAGGGTTAGGG-3 ss dna single stranded deoxyribonucleic acid ss DNA ss dna human Homo sapiens Human GTTAGGGTTAGGGTTAGGGTTAGGGTTAGGG te2ip_human Telomeric repeat-binding factor 2-interacting protein 1 DRIP5 TERF2IP RAP1 PP8000 Dopamine receptor-interacting protein 5 Repressor/activator protein 1 homolog protein protein human Homo sapiens Human MAEAMDLGKDPNGPTHSSTLFVRDDGSSMSFYVRPSPAKRRLSTLILHGGGTVCRVQEPGAVLLAQPGEALAEASGDFISTQYILDCVERNERLELEAYRLGPASAADTGSEAKPGALAEGAAEPEPQRHAGRIAFTDADDVAILTYVKENARSPSSVTGNALWKAMEKSSLTQHSWQSLKDRYLKHLRGQEHKYLLGDAPVSPSSQKLKRKAEEDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEVVVDESPPDFEIHITMCDDDPPTPEEDSETQPDEEEEEEEEKVSQPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSAFLASGQRADGYPIWSRQDDIDLQKDDEDTREALVKKFGAQNVARRIEFRKK terf2_human Telomeric repeat-binding factor 2 TTAGGG repeat-binding factor 2 Telomeric DNA-binding protein TERF2 TRF2 TRBF2 protein protein human Homo sapiens Human MAAGAGTAGPASGPGVVRDPAASQPRKRPGREGGEGARRSDTMAGGGGSSDGSGRAAGRRASRSSGRARRGRHEPGLGGPAERGAGEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGKEHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNIIREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKALKSESAASSTGKEDKQPAPGPVEKPPREPARQLRNPPTTIGMMTLKAAFKTLSGAQDSEAAFAKLDQKDLVLPTQALPASPALKNKRPRKDENESSAPADGEGGSELQPKNKRMTISRLVLEEDSQSTEPSAGLNSSQEAASAPPSKPTVLNQPLPGEKNPKVPKGKWNSSNGVEEKETWVEEDELFQVQAAPDEDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN acd-obfc1-2 1444760 n/a 1444769 unspecified role unspecified role neutral component neutral component living cell living cell yfp n-terminus fragment tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1444770 unspecified role unspecified role neutral component neutral component living cell living cell binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false yfp c-terminus fragment tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figures 2 C & D acd-obfc1-3 1444760 n/a 1444770 unspecified role unspecified role neutral component neutral component living cell living cell yfp n-terminal fragment tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1444769 unspecified role unspecified role neutral component neutral component living cell living cell binding region required to bind necessary binding region required to bind deletion analysis deletion analysis range range certain certain sequence position certain false The OBFC1-deltaC-YFPc construct shows stronger binding to YFPn-TPP1 than either whole length OBFC1-YFPc or OBFC1-deltaN100-YFPc constructs. This indicates that the N-terminus containing the OB region (1-156) may inhibit TPP1-OBFC1 interaction. yfp c-terminal fragment tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figure 2 E acd-obfc1-1 1444761 n/a 1444771 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1444772 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1444773 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1444774 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1444775 unspecified role unspecified role bait bait cell lysate cell lysate n/a 1444776 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1444777 unspecified role unspecified role prey prey cell lysate cell lysate association association false false false Figure 1 A obfc1-acd-1 1444762 n/a 1444770 unspecified role unspecified role prey prey cell lysate cell lysate n/a 1444769 unspecified role unspecified role bait bait cell lysate cell lysate flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 2 B acd-obfc1-4 1444763 n/a 1444770 unspecified role unspecified role neutral component neutral component living cell living cell yfp n-terminal fragment tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1444769 unspecified role unspecified role neutral component neutral component living cell living cell yfp c-terminal fragment tag cyfp cYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false binding region required to bind necessary binding region required to bind deletion analysis deletion analysis range range certain certain sequence position certain false physical association physical association false false false Figure 2 F telg31-obfc1 1444764 n/a 1444769 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 9bact Bacteria n/a 1444778 unspecified role unspecified role bait bait 32p radiolabel 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Figure 3 A obfc1-terf2ip-1 1444765 n/a 1444779 unspecified role unspecified role neutral component neutral component fixed cell fixed cell n/a 1444769 unspecified role unspecified role neutral component neutral component fixed cell fixed cell colocalization colocalization false false false Figure 3 B obfc1-terf2-4 1444766 n/a 1444780 unspecified role unspecified role neutral component neutral component fixed cell fixed cell n/a 1444769 anti-tag immunocytochemistry anti-tag immunocytochemistry unspecified role unspecified role neutral component neutral component fixed cell fixed cell binding region required to bind necessary binding region required to bind deletion analysis deletion analysis range range certain certain sequence position certain false flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Figure 3 C telg31-obfc1-1 1444767 n/a 1444769 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 9bact Bacteria n/a 1444778 unspecified role unspecified role bait bait 32p radiolabel 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Figure 3 A acd-obfc1-5 1444768 n/a 1444775 unspecified role unspecified role bait bait cell lysate cell lysate n/a 1444774 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association false false false Figure 2 A