bhf-ucl yamamoto-2007a-1 Enhanced TLR-mediated NF-IL6 dependent gene expression by Trib1 deficiency. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Yamamoto M., Uematsu S., Okamoto T., Matsuura Y., Sato S., Kumar H., Satoh T., Saitoh T., Takeda K., Ishii K.J., Takeuchi O., Kawai T., Akira S. Cardiac - Interactions involving cardiac related proteins sakira@biken.osaka-u.ac.jp J. Exp. Med. (0022-1007) 2007 Only protein-protein interactions imex curation yamamoto-2007a-5 Enhanced TLR-mediated NF-IL6 dependent gene expression by Trib1 deficiency. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yamamoto M., Uematsu S., Okamoto T., Matsuura Y., Sato S., Kumar H., Satoh T., Saitoh T., Takeda K., Ishii K.J., Takeuchi O., Kawai T., Akira S. Cardiac - Interactions involving cardiac related proteins sakira@biken.osaka-u.ac.jp J. Exp. Med. (0022-1007) 2007 Only protein-protein interactions imex curation yamamoto-2007a-6 Enhanced TLR-mediated NF-IL6 dependent gene expression by Trib1 deficiency. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yamamoto M., Uematsu S., Okamoto T., Matsuura Y., Sato S., Kumar H., Satoh T., Saitoh T., Takeda K., Ishii K.J., Takeuchi O., Kawai T., Akira S. Cardiac - Interactions involving cardiac related proteins sakira@biken.osaka-u.ac.jp Human lung Matchmaker cDNA library J. Exp. Med. (0022-1007) 2007 Only protein-protein interactions imex curation yamamoto-2007a-7 Enhanced TLR-mediated NF-IL6 dependent gene expression by Trib1 deficiency. in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Yamamoto M., Uematsu S., Okamoto T., Matsuura Y., Sato S., Kumar H., Satoh T., Saitoh T., Takeda K., Ishii K.J., Takeuchi O., Kawai T., Akira S. Cardiac - Interactions involving cardiac related proteins The nuclear extracts were preincubated with anti-NF-IL6 followed by EMSA sakira@biken.osaka-u.ac.jp J. Exp. Med. (0022-1007) 2007 Only protein-protein interactions imex curation trib1_mouse Tribbles homolog 1 Trib1 Trb1 protein protein mouse Mus musculus Mouse MRVGPVRFALSGASQPRGPGLLFPAARGTPAKRLLDTDDAGAVAAKCPRLSECSSPPDYLSPPGSPCSPQPPPSTQGTGGSCVSSPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKEFPIKHYQDKIRPYIQLPSHSNITGIVEVLLGESKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRKFVFSTEERTQLRLESLEDTHIIKGEDDALSDKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVGRYPFHDSDPSALFSKIRRGQFCIPEHVSPKARCLIRSLLRREPSERLTAPQILLHPWFEYVLEPGYVDSEIGTSDQIVPEYQEDSDISSFFC cebpb_mouse CCAAT/enhancer-binding protein beta Cebpb Interleukin-6-dependent-binding protein Liver-enriched transcriptional activator AGP/EBP protein protein mouse Mus musculus Mouse MHRLLAWDAACLPPPPAAFRPMEVANFYYEPDCLAYGAKAARAAPRAPAAEPAIGEHERAIDFSPYLEPLAPAADFAAPAPAHHDFLSDLFADDYGAKPSKKPADYGYVSLGRAGAKAAPPACFPPPPPAALKAEPGFEPADCKRADDAPAMAAGFPFALRAYLGYQATPSGSSGSLSTSSSSSPPGTPSPADAKAAPAACFAGPPAAPAKAKAKKTVDKLSDEYKMRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASAGHC trib1_human Tribbles homolog 1 SKIP1 G-protein-coupled receptor-induced gene 2 protein TRIB1 C8FW GIG2 TRB1 protein protein human Homo sapiens Human MRVGPVRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPPGSPCSPQPPPAAPGAGGGSGSAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSHSNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRKFVFSTEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVGRYPFHDSDPSALFSKIRRGQFCIPEHISPKARCLIRSLLRREPSERLTAPEILLHPWFESVLEPGYIDSEIGTSDQIVPEYQEDSDISSFFC cebpb_human CCAAT/enhancer-binding protein beta CEBPB TCF5 PP9092 Liver activator protein Nuclear factor NF-IL6 Transcription factor 5 Liver-enriched inhibitory protein protein protein human Homo sapiens Human MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC c/ebp dna consensus Consensus C/EBP DNA binding sequence dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) TGCAGATTGCGCAATCTGCA trib1-cebpb 1480559 n/a 1480563 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1480564 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2B trib1-cebpb-2 1480560 n/a 1480565 unspecified role unspecified role bait bait n/a 1480566 unspecified role unspecified role prey prey n-terminal_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2A trib1-cebpb-3 1480561 n/a 1480566 unspecified role unspecified role prey prey n-terminal_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1480565 unspecified role unspecified role bait bait physical association physical association false false false no figure c_ebp_dna_consensus-cebpb-1 1480562 n/a 1480564 antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey mouse-macrophage Mus musculus macrophage macrophage Macrophage n/a 1480567 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig 4B