IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ anthony-2007-3 in vitro In vitro electrophoresis electrophoretic mobility-based method electrophoresis western blot western blot Immuno blot Immuno blot Anthony DF., Beattie J., Paul A., Currie S. Cardiac - Interactions involving cardiac related proteins Interactions involving the CaMKIIdeltaC construct have not been included as the origin of this construct cannot be traced and the corresponding author did not reply to a request for information. susan.currie@strath.ac.uk Journal of molecular and cellular cardiology 2007 Only protein-protein interactions imex curation imex curation sorcn_crigr Sorcin 22 kDa protein CP-22 V19 SRI protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MAYPGHPGAGGGYYPGGYGGAPGGPSFPGQTQDPLYGYFASVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDSDRSGTVDPQELQKALTTMGFRLNPQTVNSIAKRYSTSGKITFDDYIACCVKLRALTDSFRRRDSAQQGMVNFSYDDFIQCVMTV sri-10 1796384 N/A 1796385 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false 3C