bhf-ucl gallagher-2000-1 The polycystic kidney disease protein PKD2 interacts with Hax-1, a protein associated with the actin cytoskeleton. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gallagher A.R., Cedzich A., Gretz N., Somlo S., Witzgall R. Cardiac - Interactions involving cardiac related proteins Fig 6 a and b were not annotated because of lack of information about the origin of the recombinant cortactin Ralph.Witzgall@vkl.uni-regensburg.de ralph.witzgall@urz.uni-heidelberg.de mouse embryonic day 13-14 cDNA library Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2000 imex curation Only protein-protein interactions gallagher-2000-2 The polycystic kidney disease protein PKD2 interacts with Hax-1, a protein associated with the actin cytoskeleton. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gallagher A.R., Cedzich A., Gretz N., Somlo S., Witzgall R. Cardiac - Interactions involving cardiac related proteins Fig 6 a and b were not annotated because of lack of information about the origin of the recombinant cortactin Ralph.Witzgall@vkl.uni-regensburg.de ralph.witzgall@urz.uni-heidelberg.de Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2000 imex curation Only protein-protein interactions gallagher-2000-3 The polycystic kidney disease protein PKD2 interacts with Hax-1, a protein associated with the actin cytoskeleton. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Gallagher A.R., Cedzich A., Gretz N., Somlo S., Witzgall R. Cardiac - Interactions involving cardiac related proteins Fig 6 a and b were not annotated because of lack of information about the origin of the recombinant cortactin Ralph.Witzgall@vkl.uni-regensburg.de ralph.witzgall@urz.uni-heidelberg.de Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2000 imex curation Only protein-protein interactions gallagher-2000-5 The polycystic kidney disease protein PKD2 interacts with Hax-1, a protein associated with the actin cytoskeleton. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gallagher A.R., Cedzich A., Gretz N., Somlo S., Witzgall R. Cardiac - Interactions involving cardiac related proteins Fig 6 a and b were not annotated because of lack of information about the origin of the recombinant cortactin Ralph.Witzgall@vkl.uni-regensburg.de ralph.witzgall@urz.uni-heidelberg.de Human adult kidney cDNA library Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2000 imex curation Only protein-protein interactions pkd2_human Polycystin-2 PKD2 Polycystic kidney disease 2 protein Autosomal dominant polycystic kidney disease type II protein Polycystwin R48321 TRPP2 Transient receptor potential cation channel subfamily P member 2 protein protein human Homo sapiens Human MVNSSRVQPQQPGDAKRPPAPRAPDPGRLMAGCAAVGASLAAPGGLCEQRGLEIEMQRIRQAAARDPPAGAAASPSPPLSSCSRQAWSRDNPGFEAEEEEEEVEGEEGGMVVEMDVEWRPGSRRSAASSAVSSVGARSRGLGGYHGAGHPSGRRRRREDQGPPCPSPVGGGDPLHRHLPLEGQPPRVAWAERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFLEDQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGGNGSSNVHV Functions as a calcium permeable cation channel. PKD1 and PKD2 may function through a common signaling pathway that is necessary for normal tubulogenesis Defects in PKD2 are the cause of polycystic kidney disease autosomal dominant type 2 (ADPKD2) [MIM:173900]. ADPKD2 represents approximately 15% of the cases of ADPKD, a common genetic disease affecting about 1:400 to 1:1000 individuals. ADPKD is characterized by progressive formation and enlargement of cysts in both kidneys, typically leading to end-stage renal disease in adult life. Cysts also occurs in the liver and other organs. ADPKD2 is clinically milder than ADPKD1 but it has a deleterious impact on overall life expectancy mint hax1_mouse HCLS1-associated protein X-1 HS1-associating protein X-1 HS1-binding protein 1 Hax1 Hs1bp1 protein protein mouse Mus musculus Mouse MSVFDLFRGFFGFPGPRSHRDPFFGGMTRDDDDDDDDDDEAEEDRGAWGRESYAFDGSQPPEEFGFSFSPRGGMRFHGNFGFDDLVRDFNSIFSEMGAWTLPSHSPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFEGVLESHAKPESPKPAPDWGSQGPFHRLDDTWPVSPHSRAKEDKDLDSQVSQEGLGPLLQPQPKSYFKSISVTKITKPDGTVEERRTVVDSEGRRETTVTHQEAHDSSRSDPDSQRSSALDDPFSILDLLLGRWFRSR hax1_human HCLS1-associated protein X-1 HAX1 HS1BP1 HS1-associating protein X-1 HS1-binding protein 1 protein protein human Homo sapiens Human MSLFDLFRGFFGFPGPRSHRDPFFGGMTRDEDDDEEEEEEGGSWGRGNPRFHSPQHPPEEFGFGFSFSPGGGIRFHDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQPKSYFKSISVTKITKPDGIVEERRTVVDSEGRTETTVTRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR pkd2-hax1-1 1554554 n/a 1554558 unspecified role unspecified role bait bait loop 5 sufficient to bind sufficient binding region sufficient to bind range range range range false n/a 1554559 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1A pkd2-hax1-2 1554555 n/a 1554558 unspecified role unspecified role bait bait loop 5 sufficient to bind sufficient binding region sufficient to bind range range range range false n/a 1554559 unspecified role unspecified role prey prey c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig.2 A pkd2-hax1-3 1554556 n/a 1554558 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1554559 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fg. 3 pkd2-hax1-7 1554557 n/a 1554558 unspecified role unspecified role bait bait loop 5 sufficient to bind sufficient binding region sufficient to bind range range range range false n/a 1554560 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false no figure