IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ byrne-1998-1 Identification of homo- and heteromeric interactions between members of the breast carcinoma-associated D52 protein family using the yeast two-hybrid system. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Byrne JA., Nourse CR., Basset P., Gunning P. Cancer - Interactions investigated in the context of cancer 2 and 3 Oncogene (0950-9232) 1998 Only protein-protein interactions imex curation byrne-1998-2 Identification of homo- and heteromeric interactions between members of the breast carcinoma-associated D52 protein family using the yeast two-hybrid system. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Byrne JA., Nourse CR., Basset P., Gunning P. Cancer - Interactions investigated in the context of cancer 2 and 3 Two hybrid screening of a human breast carcinoma cDNA expression library in yeast strain Y190. Oncogene (0950-9232) 1998 Only protein-protein interactions imex curation byrne-1998-4 Identification of homo- and heteromeric interactions between members of the breast carcinoma-associated D52 protein family using the yeast two-hybrid system. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Byrne JA., Nourse CR., Basset P., Gunning P. Cancer - Interactions investigated in the context of cancer 2 and 3 Oncogene (0950-9232) 1998 Only protein-protein interactions imex curation byrne-1998-3 Identification of homo- and heteromeric interactions between members of the breast carcinoma-associated D52 protein family using the yeast two-hybrid system. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Byrne JA., Nourse CR., Basset P., Gunning P. Cancer - Interactions investigated in the context of cancer 2 and 3 Yeast two hybrid screening of a human breast carcinoma cDNA library in yeast strain Hf7c. Oncogene (0950-9232) 1998 Only protein-protein interactions imex curation tpd52_human Tumor protein D52 Protein N8 TPD52 protein protein human Homo sapiens Human MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKFGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL tpd52_mouse Tumor protein D52 Tpd52 protein protein mouse Mus musculus Mouse MECRDMELADDYQSPFDFDSGVNKNYLYLSPSGNTSPPGSPTQNVGLLKTEPVAEEGEDAVTMLSAPEALTEEEQEELRRELTKVEEEIQTLSQVLAAKEKHLAELKRKLGISSLQEFKQNIAKGWQDVTATNAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGAKPAGGDFGEVLNSTANATSTMTTEPPPEQMTESP tpd53_human Tumor protein D53 Tumor protein D52-like 1 TPD52L1 protein protein human Homo sapiens Human MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC o43399-1 Tumor protein D54 HD54+ins2 TPD52L2 Tumor protein D52-like 2 protein protein human Homo sapiens Human MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF o43399-2 Tumor protein D54 HD54-ins2 TPD52L2 Tumor protein D52-like 2 protein protein human Homo sapiens Human MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF hd52-hd52-1 Homodimerisation of human D52 detected by Y2H 302978 N/A 302982 unspecified role unspecified role prey prey in vitro In vitro N/A 302982 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false hd52-md52-1 Interaction between human D52 and mouse D52 detected by Y2H 302978 N/A 302983 unspecified role unspecified role prey prey partial md52 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 302982 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false hd52-hd53-1 Interaction between human D52 and human D53 detected by Y2H 302978 N/A 302984 unspecified role unspecified role prey prey in vitro In vitro N/A 302982 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false hd52-hd54ins2-1 Interaction between human D52 and human D54+ins2 detected by Y2H 302978 N/A 302985 unspecified role unspecified role prey prey in vitro In vitro N/A 302982 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false hd52-hd54-ins2-1 Interaction between human D52 and human D54-ins2 detected by Y2H 302978 N/A 302986 unspecified role unspecified role prey prey in vitro In vitro N/A 302982 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false md52-hd53-1 Interaction between mouse D52 and human D53 detected by Y2H 302978 N/A 302984 unspecified role unspecified role prey prey in vitro In vitro N/A 302983 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false hd53-hd52-1 Interaction between human D53 and human D52 detected by Y2H 302978 N/A 302982 unspecified role unspecified role prey prey in vitro In vitro N/A 302984 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false hd53-md52-1 Interaction between human D53 and mouse D52 detected by Y2H 302978 N/A 302984 unspecified role unspecified role bait bait in vitro In vitro N/A 302983 unspecified role unspecified role prey prey partial md52 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false hd53-hd53-1 Homodimerisation of human D53 detected by Y2H 302978 N/A 302984 unspecified role unspecified role prey prey in vitro In vitro N/A 302984 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false hd53-hd54ins2-1 Interaction between human D53 and human D54+ins2 detected by Y2H 302978 N/A 302984 unspecified role unspecified role bait bait in vitro In vitro N/A 302985 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false hd53-hd54-ins2-1 Interaction between human D53 and human D54-ins2 detected by Y2H 302978 N/A 302986 unspecified role unspecified role prey prey in vitro In vitro N/A 302984 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false hd54ins2-hd52-1 Interaction between human D54+ins2 and human D52 detected by Y2H 302978 N/A 302982 unspecified role unspecified role prey prey in vitro In vitro N/A 302985 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false hd54ins2-md52-1 Interaction between human D54+ins2 and mouse D52 detected by Y2H 302978 N/A 302985 unspecified role unspecified role bait bait in vitro In vitro N/A 302983 unspecified role unspecified role prey prey partial md52 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false hd54ins2-hd53-1 Interaction between human D54+ins2 and human D53 detected by Y2H 302978 N/A 302984 unspecified role unspecified role prey prey in vitro In vitro N/A 302985 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false hd54ins2-hd54ins2-1 Homodimerisation of human D54+ins2 detected by Y2H 302978 N/A 302985 unspecified role unspecified role prey prey in vitro In vitro N/A 302985 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false hd54ins2-hd54-ins2-1 Interaction between human D54+ins2 and human D54-ins2 detected by Y2H 302978 N/A 302986 unspecified role unspecified role prey prey in vitro In vitro N/A 302985 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false hd54-ins2-hd52-1 Interaction between human D54-ins2 and human D52 detected by Y2H 302978 N/A 302986 unspecified role unspecified role bait bait in vitro In vitro N/A 302982 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false hd54-ins2-md52-1 Interaction between human D54-ins2 and mouse D52 detected by Y2H 302978 N/A 302986 unspecified role unspecified role bait bait in vitro In vitro N/A 302983 unspecified role unspecified role prey prey partial md52 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false hd54-ins2-hd53-1 Interaction between human D54-ins2 and human D53 detected by Y2H 302978 N/A 302984 unspecified role unspecified role prey prey in vitro In vitro N/A 302986 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false hd54-ins2-hd54ins2-1 Interaction between human D54-ins2 and human D54+ins2 detected by Y2H 302978 N/A 302985 unspecified role unspecified role prey prey in vitro In vitro N/A 302986 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false hd54-ins2homodimer-1 Homodimerisation of human D54-ins2 detected by Y2H 302978 N/A 302986 unspecified role unspecified role bait bait in vitro In vitro N/A 302986 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false md52-hd53-2 Interaction between mouse D52 and human D53 detected by Y2H 302978 N/A 302983 unspecified role unspecified role bait bait n-term md52 N-terminus of mouse D52 required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 302984 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false hd53-hd53-2 Homodimerisation of human D53 detected by Y2H 302979 N/A 302984 unspecified role unspecified role prey prey in vitro In vitro N/A 302984 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false hd53-hd53-3 Interaction between human D53 and human D53 isoform detected by Y2H 302979 N/A 302984 unspecified role unspecified role bait bait in vitro In vitro n/a 302984 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false hd53-hd53-4 Interaction between human D53 and partial human D53 detected by Y2H 302979 N/A 302984 unspecified role unspecified role prey prey partial hd53 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 302984 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false md52-md52-1 Homodimerisation of mouse D52 detected by GST pulldown 302980 N/A 302983 unspecified role unspecified role bait bait ecobb Escherichia coli (strain B / BL21) N/A 302983 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction false false false md52-hd52-1 Interaction between mouse D52 and human D52 detected by GST pulldown 302980 N/A 302983 unspecified role unspecified role bait bait ecobb Escherichia coli (strain B / BL21) N/A 302982 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction false false false md52-hd54_ins2-1 Interaction between mouse D52 and human D54-ins2 detected by GST pulldown 302980 N/A 302986 unspecified role unspecified role prey prey in vitro In vitro N/A 302983 unspecified role unspecified role bait bait ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false hd52-hd53-2 Interaction between human D52 and human D53 detected by Y2H 302981 N/A 302982 unspecified role unspecified role bait bait in vitro In vitro N/A 302984 unspecified role unspecified role prey prey partial hd53 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false hd52-hd52-2 Homodimerisation of human D52 detected by Y2H 302981 N/A 302982 unspecified role unspecified role bait bait in vitro In vitro N/A 302982 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false