IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mezzadra-2017-2 human-8505C human- 8505C undifferentiated thyroid carcinoma cell line Human 8505c 8505C-undifferentiated thyroid carcinoma cell line DSMZ: ACC 219 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mezzadra R., Sun C., Jae LT., Gomez-Eerland R., de Vries E., Wu W., Logtenberg MEW., Slagter M., Rozeman EA., Hofland I., Broeks A., Horlings HM., Wessels LFA., Blank CU., Xiao Y., Heck AJR., Borst J., Brummelkamp TR., Schumacher TNM., Mezzadra R., Sun C., Jae LT., Gomez-Eerland R., de Vries E., Wu W., Logtenberg MEW., Slagter M., Rozeman EA., Hofland I., Broeks A., Horlings HM., Wessels LFA., Blank CU., Xiao Y., Heck AJR., Borst J., Brummelkamp TR., Schumacher TNM. Cancer - Interactions investigated in the context of cancer t.brummelkamp@nki.nl, t.schumacher@nki.nl Nature 2017 imex curation Only protein-protein interactions imex curation mezzadra-2017-1 human-a375 Human malignant melanoma a375 Human malignant melanoma ATCC catalog # CRL-1872 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mezzadra R., Sun C., Jae LT., Gomez-Eerland R., de Vries E., Wu W., Logtenberg MEW., Slagter M., Rozeman EA., Hofland I., Broeks A., Horlings HM., Wessels LFA., Blank CU., Xiao Y., Heck AJR., Borst J., Brummelkamp TR., Schumacher TNM., Mezzadra R., Sun C., Jae LT., Gomez-Eerland R., de Vries E., Wu W., Logtenberg MEW., Slagter M., Rozeman EA., Hofland I., Broeks A., Horlings HM., Wessels LFA., Blank CU., Xiao Y., Heck AJR., Borst J., Brummelkamp TR., Schumacher TNM. Cancer - Interactions investigated in the context of cancer t.brummelkamp@nki.nl, t.schumacher@nki.nl Nature 2017 imex curation Only protein-protein interactions imex curation mezzadra-2017-3 human-rko Homo sapiens colorectal carcinoma cell line rko Human colorectal carcinoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mezzadra R., Sun C., Jae LT., Gomez-Eerland R., de Vries E., Wu W., Logtenberg MEW., Slagter M., Rozeman EA., Hofland I., Broeks A., Horlings HM., Wessels LFA., Blank CU., Xiao Y., Heck AJR., Borst J., Brummelkamp TR., Schumacher TNM., Mezzadra R., Sun C., Jae LT., Gomez-Eerland R., de Vries E., Wu W., Logtenberg MEW., Slagter M., Rozeman EA., Hofland I., Broeks A., Horlings HM., Wessels LFA., Blank CU., Xiao Y., Heck AJR., Borst J., Brummelkamp TR., Schumacher TNM. Cancer - Interactions investigated in the context of cancer t.brummelkamp@nki.nl, t.schumacher@nki.nl Nature 2017 imex curation Only protein-protein interactions imex curation mezzadra-2017-5 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Mezzadra R., Sun C., Jae LT., Gomez-Eerland R., de Vries E., Wu W., Logtenberg MEW., Slagter M., Rozeman EA., Hofland I., Broeks A., Horlings HM., Wessels LFA., Blank CU., Xiao Y., Heck AJR., Borst J., Brummelkamp TR., Schumacher TNM., Mezzadra R., Sun C., Jae LT., Gomez-Eerland R., de Vries E., Wu W., Logtenberg MEW., Slagter M., Rozeman EA., Hofland I., Broeks A., Horlings HM., Wessels LFA., Blank CU., Xiao Y., Heck AJR., Borst J., Brummelkamp TR., Schumacher TNM. Cancer - Interactions investigated in the context of cancer Interactions involving chimeric molecules have not been added, as they are of dubious biological relevance. t.brummelkamp@nki.nl, t.schumacher@nki.nl Nature 2017 imex curation Only protein-protein interactions imex curation cklf6_human CKLF-like MARVEL transmembrane domain-containing protein 6 Chemokine-like factor superfamily member 6 CMTM6 CKLFSF6 protein protein human Homo sapiens Human MENGAVYSPTTEEDPGPARGPRSGLAAYFFMGRLPLLRRVLKGLQLLLSLLAFICEEVVSQCTLCGGLYFFEFVSCSAFLLSLLILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVFGFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNA pd1l1_human Programmed cell death 1 ligand 1 CD274 B7H1 PDCD1L1 PDCD1LG1 PDL1 B7 homolog 1 protein protein human Homo sapiens Human MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET cklf4_human CKLF-like MARVEL transmembrane domain-containing protein 4 CMTM4 CKLFSF4 Chemokine-like factor superfamily member 4 protein protein human Homo sapiens Human MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFICIETIMACSPCEGLYFFEFVSCSAFVVTGVLLIMFSLNLHMRIPQINWNLTDLVNTGLSAFLFFIASIVLAALNHRAGAEIAAVIFGFLATAAYAVNTFLAVQKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQLA pd1l2_human Programmed cell death 1 ligand 2 Butyrophilin B7-DC PDCD1LG2 B7DC CD273 PDCD1L2 PDL2 protein protein human Homo sapiens Human MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPTWLLHIFIPFCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI cd274-cmtm6-6 3317103 N/A 3317107 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3317108 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Extended Data 7 B IFN-gamma cd274-cmtm6-4 3317103 N/A 3317107 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3317108 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Extended Data 7B cd274-cmtm6-8 3317103 N/A 3317107 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3317109 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3317108 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Extended Data 7D cd274-cmtm4-1 3317103 N/A 3317109 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3317108 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Extended Data 7Di cd274-cmtm4-2 3317103 N/A 3317107 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3317109 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3317108 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Extended Data 7Di only a weak band is seen for CMTM4 cmtm6-cd274-2 3317103 N/A 3317107 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3317109 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3317108 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Extended Data 7Dii Only a weak band is seen for CMTM6. In the CMTM6 knockout cells there appears to be little or no interaction with PD-L1. cd274-cmtm6-2 3317104 N/A 3317107 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3317108 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false 4D, lanes 9+10 IFN-gamma cd274-cmtm6-1 3317104 N/A 3317107 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3317108 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 4D, lanes 1+ 2 IFN-gamma cd274-cmtm6-3 3317104 N/A 3317107 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3317108 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 4D, lanes 7+8 IFN-gamma cd274-cmtm6-7 3317104 N/A 3317108 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3317107 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Extended data 7A, lanes 9+10 IFN-gamma cd274-cmtm6-5 3317105 N/A 3317107 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3317108 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Extended Data 7C cmtm6-cd274-1 3317105 N/A 3317107 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3317108 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3317109 unspecified role unspecified role prey prey association association false false false Extended Data 7C cd274-cmtm6-9 3317106 N/A 3317107 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3317108 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3317110 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Supp 8 F/G Only a faint band is seen for endogenous PD-L2.