IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ duran-2016-4 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Duran A., Hernandez ED., Reina-Campos M., Castilla EA., Subramaniam S., Raghunandan S., Roberts LR., Kisseleva T., Karin M., Diaz-Meco MT., Moscat J. Cancer - Interactions investigated in the context of cancer HA-p62 is of Human origin; see pmid:9566925, via links from Duran et al. 2011 et al.. mdmeco@sbpdiscovery.org,jmoscat@sbpdiscovery.org Cancer cell 2016 imex curation Only protein-protein interactions duran-2016-1 mouse-hsc mouse-Hepatic Stellate Cells Mouse hsc hepatic stellate cell ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Duran A., Hernandez ED., Reina-Campos M., Castilla EA., Subramaniam S., Raghunandan S., Roberts LR., Kisseleva T., Karin M., Diaz-Meco MT., Moscat J. Cancer - Interactions investigated in the context of cancer mdmeco@sbpdiscovery.org,jmoscat@sbpdiscovery.org Cancer cell 2016 imex curation Only protein-protein interactions duran-2016-3 mouse-hsc mouse-Hepatic Stellate Cells Mouse hsc hepatic stellate cell pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Duran A., Hernandez ED., Reina-Campos M., Castilla EA., Subramaniam S., Raghunandan S., Roberts LR., Kisseleva T., Karin M., Diaz-Meco MT., Moscat J. Cancer - Interactions investigated in the context of cancer mdmeco@sbpdiscovery.org,jmoscat@sbpdiscovery.org Cancer cell 2016 imex curation Only protein-protein interactions duran-2016-2 mouse-hsc mouse-Hepatic Stellate Cells Mouse hsc hepatic stellate cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Duran A., Hernandez ED., Reina-Campos M., Castilla EA., Subramaniam S., Raghunandan S., Roberts LR., Kisseleva T., Karin M., Diaz-Meco MT., Moscat J. Cancer - Interactions investigated in the context of cancer mdmeco@sbpdiscovery.org,jmoscat@sbpdiscovery.org Cancer cell 2016 imex curation Only protein-protein interactions duran-2016-5 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Duran A., Hernandez ED., Reina-Campos M., Castilla EA., Subramaniam S., Raghunandan S., Roberts LR., Kisseleva T., Karin M., Diaz-Meco MT., Moscat J. Cancer - Interactions investigated in the context of cancer MBP-p62 is of Human origin - see previous publication(s) pmid:9566925 mdmeco@sbpdiscovery.org,jmoscat@sbpdiscovery.org Cancer cell 2016 imex curation Only protein-protein interactions sqstm_human Sequestosome-1 SQSTM1 ORCA OSIL Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa Ubiquitin-binding protein p62 EBI3-associated protein of 60 kDa protein protein human Homo sapiens Human MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL rxra_mouse Retinoic acid receptor RXR-alpha Rxra Nr2b1 Retinoid X receptor alpha Nuclear receptor subfamily 2 group B member 1 protein protein mouse Mus musculus Mouse MDTKHFLPLDFSTQVNSSSLNSPTGRGSMAVPSLHPSLGPGIGSPLGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSTEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQAT vdr_human Vitamin D3 receptor 1,25-dihydroxyvitamin D3 receptor Nuclear receptor subfamily 1 group I member 1 VDR NR1I1 protein protein human Homo sapiens Human MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVFGNEIS cp24a_mouse_gene 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial Cyp24a1 Cyp-24 Cyp24 gene gene mouse Mus musculus Mouse vdr_mouse Vitamin D3 receptor Vdr Nr1i1 1,25-dihydroxyvitamin D3 receptor Nuclear receptor subfamily 1 group I member 1 protein protein mouse Mus musculus Mouse MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMIMKRKEEEALKDSLRPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPIRADVSTGSYSPRPTLSFSGDSSSNSDLYTPSLDMMEPASFSTMDLNEEGSDDPSVTLDLSPLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTLDDMSWDCGSQDYKYDITDVSRAGHTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGNEIS co1a1_mouse_gene Collagen alpha-1(I) chain Col1a1 Cola1 Alpha-1 type I collagen gene gene mouse Mus musculus Mouse smad3_mouse Mothers against decapentaplegic homolog 3 Smad3 Madh3 SMAD family member 3 protein protein mouse Mus musculus Mouse MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS acta_mouse_gene Actin, aortic smooth muscle Acta2 Actsa Actvs gene gene mouse Mus musculus Mouse sqstm_mouse Sequestosome-1 Ubiquitin-binding protein p62 STONE14 Sqstm1 A170 STAP protein protein mouse Mus musculus Mouse MASFTVKAYLLGKEEATREIRRFSFCFSPEPEAEAQAAAGPGPCERLLSRVAVLFPTLRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRREHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHREHSKLIFPNPFGHLSDSFSHSRWLRKLKHGHFGWPGWEMGPPGNWSPRPPRAGDGRPCPTAESASAPPEDPNVNFLKNVGESVAAALSPLGIEVDIDVEHGGKRSRLTPTTPESSSTGTEDKSNTQPSSCSSEVSKPDGAGEGPAQSLTEQMKKIALESVGQPEEQMESGNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL ncoa1_mouse Nuclear receptor coactivator 1 Ncoa1 Src1 Nuclear receptor coactivator protein 1 Steroid receptor coactivator 1 protein protein mouse Mus musculus Mouse MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSLSVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEALDGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNGVPWPQEATRRNSHTFNCRMLIHPPEDPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQSCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMGIHIIDREHSGLSPQDDSNSGMSIPRINPSVNPGISPAHGVTRSSTLPPSNNNMVSARVNRQQSSDLNSSSSHTNSSNNQGNFGCSPGNQIVANVALNQGQAGSQSSNPSLNLNNSPMEGTGIALSQFMSPRRQANSGLATRARMSNNSFPPNIPTLSSPVGITSGACNNNNRSYSNIPVTSLQGMNEGPNNSVGFSAGSPVLRQMSSQNSPSRLSMQPAKAESKDSKEIASILNEMIQSDNSDNSANEGKPLDSGLLHNNDRLSEGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLSCTGTSSSASSNPSGGTCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPEKKDSVPASTAVSVSGQSQGSASIKLELDAAKKKESKDHQLLRYLLDKDEKDLRSTPNLCLDDVKVKVEKKEQMDPCNTNPTPMTKPAPEEVKLESQSQFTADLDQFDQLLPTLEKAAQLPSLCETDRMDGAVTGVSIKAEVLPASLQPTTARAAPRLSRLPELELEAIDNQFGQPGAGDQIPWANNTLTTINQNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKLVQGGGLDVLSERFPPQQATPPLMMEDRPTLYSQPYSSPSPTAGLSGPFQGMVRQKPSLGAMPVQVTPPRGTFSPNMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLMHQNRQAILNQFAANAPVGMNMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQIIQQQRAMLMRHQSFGNNIPPSSGLPVQMGTPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLATRSSMVNRGMAGNMGGQFGAGISPQMQQNVFQYPGPGLVPQGEATFAPSLSPGSSMVPMPVPPPQSSLLQQTPPTSGYQSPDMKAWQQGTMGNNNVFSQAVQSQPAPAQPGVYNNMSITVSMAGGNANIQNMNPMMGQMQMSSLQMPGMNTVCSEQMNDPALRHTGLYCNQLSSTDLLKTDADGNQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLTE rxra_human Retinoic acid receptor RXR-alpha RXRA NR2B1 Retinoid X receptor alpha Nuclear receptor subfamily 2 group B member 1 protein protein human Homo sapiens Human MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT vdr-rxra-2 2865178 N/A 2865183 stimulator stimulator prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q13501:p.Lys7Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q13501:p.Val188_Lys189delinsAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false N/A 2865184 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2865185 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6 D/L p62 increased the formation of the heterodimer between VDR and RXRA. vdr-rxra-3 2865178 N/A 2865184 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2865185 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 6Di, Supp 5I The absence of p62 in the KO cell line reduces the interaction. vdr-rxra-4 2865178 N/A 2865183 unspecified role unspecified role prey prey pb1_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2865185 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P11473:p.[Lys246Ala;Glu420Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 6H, Supp5N vdr-rxra-5 2865178 N/A 2865183 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2865185 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp 5A sqstm1-rxra-1 2865178 N/A 2865183 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2865184 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp 5A-2 vdr-rxra-6 2865178 N/A 2865183 unspecified role unspecified role bait bait n_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind range range certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q13501:p.Val188_Lys189delinsAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false N/A 2865184 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 6 J, Supp 5 K/L sqstm1-rxra-3 2865178 N/A 2865183 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2865184 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind range range range range false physical association physical association false false false Fig 6 K, Supp 5 M 2t4w\rsg-1 2865179 N/A 2865186 unspecified role unspecified role prey prey proximal_promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2865187 unspecified role unspecified role bait bait association association false false false 5F-1 Q64337 increases the binding of P48281 to ENSMUSG00000038567 p62/Sqstm1 CHEBI:50749 increases the expression at RNA level of ENSMUSG00000038567 P48281 increases expression at RNA level of ENSMUSG00000038567 CHEBI:50749 activates P48281 vdr-rxra-1 2865179 N/A 2865188 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2865187 unspecified role unspecified role bait bait association association false false false 5G p62/Sqstm1 Q64337 increases the binding of P48281 to ENSMUSG00000001506 vdr-col1a1-1 2865179 N/A 2865188 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2865189 unspecified role unspecified role bait bait association association false false false 5G-2 p62/Sqstm1 Q64337 decreases the binding of Q8BUN5 to ENSMUSG00000001506 vdr-cyp24a1-1 2865179 N/A 2865186 unspecified role unspecified role prey prey proximal_promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2865184 unspecified role unspecified role bait bait association association false false false 5F-2 Q64337 increases the binding of P28700 to ENSMUSG00000038567 p62/Sqstm1 vdr-col1a1-2 2865179 N/A 2865190 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2865187 unspecified role unspecified role bait bait association association false false false 5H p62/Sqstm1 Q64337 increases the binding of P48281 to ENSMUSG00000035783 vdr-acta2-1 2865179 N/A 2865190 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2865189 unspecified role unspecified role bait bait association association false false false 5H-2 p62/Sqstm1 Q64337 decreases the binding of Q8BUN5 to ENSMUSG00000035783 rxra-sqstm1-2 2865180 N/A 2865191 unspecified role unspecified role neutral component neutral component N/A 2865184 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 6C rxra-sqstm1-3 2865180 N/A 2865191 unspecified role unspecified role neutral component neutral component N/A 2865187 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 6C-2 Calcipotriol; a Vitamin D Receptor Agonist;a synthetic analogue of Vitamin D3-Calcitriol sqstm1-vdr-1 2865180 N/A 2865184 unspecified role unspecified role neutral component neutral component N/A 2865191 unspecified role unspecified role ancillary ancillary N/A 2865187 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 6G Calcipotriol; a Vitamin D Receptor Agonist;a synthetic analogue of Vitamin D3-Calcitriol There appeared to be limited evidence of an interaction in the absence of Calcipotriol and/or p62. sqstm1-vdr-2 2865180 N/A 2865192 unspecified role unspecified role neutral component neutral component N/A 2865187 unspecified role unspecified role neutral component neutral component N/A 2865191 unspecified role unspecified role ancillary ancillary proximity proximity close-contact colocalization neighbourhood interaction false false false 6I Calcipotriol; a Vitamin D Receptor Agonist;a synthetic analogue of Vitamin D3-Calcitriol No interaction was seen in the absence of p62. 25235-2 2865181 N/A 2865191 unspecified role unspecified role prey prey N/A 2865184 unspecified role unspecified role bait bait physical association physical association false false false 6A, Supp 5F Calcipotriol; a Vitamin D Receptor Agonist;a synthetic analogue of Vitamin D3-Calcitriol rxra-sqstm1-1 2865181 N/A 2865191 unspecified role unspecified role prey prey N/A 2865187 unspecified role unspecified role bait bait physical association physical association false false false 6B, Supp 5G Calcipotriol; a Vitamin D Receptor Agonist;a synthetic analogue of Vitamin D3-Calcitriol vdr-sqstm1-1 2865181 N/A 2865191 unspecified role unspecified role ancillary ancillary N/A 2865184 unspecified role unspecified role prey prey N/A 2865187 unspecified role unspecified role bait bait physical association physical association false false false 6F Calcipotriol; a Vitamin D Receptor Agonist;a synthetic analogue of Vitamin D3-Calcitriol No interaction was seen in p62KO cells. 7w4ase5yty-1 2865182 N/A 2865185 unspecified role unspecified role bait bait c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false 9inse 9inse N/A 2865184 unspecified role unspecified role prey prey c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false 6E The main text states that Fig 6E uses recombinant proteins( "....when analyzed in vitro with purified recombinant proteins (Figure 6E)"). However Flag-RXRA has been assumed to be of Murine origin (from transfected 293T cells, as used elsewhere) as NO human Flag tagged RXRA is listed on the stated supplier's web site (Active Motif). Calcipotriol; a Vitamin D Receptor Agonist;a synthetic analogue of Vitamin D3-Calcitriol p62 Q13501 increases the binding of P11473 to P28700 CHEBI:50749 increases the binding of P11473 to P28700 CHEBI:50749 and Q13501 synergistically increase the binding of P11473 to P28700 786de6-1 2865182 N/A 2865193 unspecified role unspecified role prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 2865183 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Supp 5B CHEBI:50749 had no effect on the binding of Q13501 to P19793 CHEBI:50749 causes no change to the binding of Q13501 to P19793 sqstm1-rxra-2 2865182 N/A 2865185 unspecified role unspecified role prey prey c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false 9inse 9inse N/A 2865183 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Supp 5 C/D Calcipotriol; a Vitamin D Receptor Agonist;a synthetic analogue of Vitamin D3-Calcitriol CHEBI:50749 decreases the binding of Q13501 to P11473