IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yang-2016-1 human-hbl-1 Human-HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype hbl-1 HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang Y., Kelly P., Shaffer AL., Schmitz R., Yoo HM., Liu X., Huang da W., Webster D., Young RM., Nakagawa M., Ceribelli M., Wright GW., Yang Y., Zhao H., Yu X., Xu W., Chan WC., Jaffe ES., Gascoyne RD., Campo E., Rosenwald A., Ott G., Delabie J., Rimsza L., Staudt LM. Cancer - Interactions investigated in the context of cancer cIAP2 was confirmed to be the protein produced from the BIRC3 gene by a blat of an shRNA sequence. lstaudt@mail.nih.gov Cancer cell 2016 Only protein-protein interactions imex curation imex curation yang-2016-2 human-tmd8 human-TMD8-diffuse large B cell lymphoma, activated B cell-like (ABC) subtype Human tmd8 TMD8-diffuse large B cell lymphoma, activated B cell-like (ABC) subtype anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang Y., Kelly P., Shaffer AL., Schmitz R., Yoo HM., Liu X., Huang da W., Webster D., Young RM., Nakagawa M., Ceribelli M., Wright GW., Yang Y., Zhao H., Yu X., Xu W., Chan WC., Jaffe ES., Gascoyne RD., Campo E., Rosenwald A., Ott G., Delabie J., Rimsza L., Staudt LM. Cancer - Interactions investigated in the context of cancer cIAP2 was confirmed to be the protein produced from the BIRC3 gene by a blat of an shRNA sequence. lstaudt@mail.nih.gov Cancer cell 2016 Only protein-protein interactions imex curation imex curation yang-2016-4 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Yang Y., Kelly P., Shaffer AL., Schmitz R., Yoo HM., Liu X., Huang da W., Webster D., Young RM., Nakagawa M., Ceribelli M., Wright GW., Yang Y., Zhao H., Yu X., Xu W., Chan WC., Jaffe ES., Gascoyne RD., Campo E., Rosenwald A., Ott G., Delabie J., Rimsza L., Staudt LM. Cancer - Interactions investigated in the context of cancer lstaudt@mail.nih.gov Cancer cell 2016 Only protein-protein interactions imex curation imex curation yang-2016-3 human-hbl-1 Human-HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype hbl-1 HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Yang Y., Kelly P., Shaffer AL., Schmitz R., Yoo HM., Liu X., Huang da W., Webster D., Young RM., Nakagawa M., Ceribelli M., Wright GW., Yang Y., Zhao H., Yu X., Xu W., Chan WC., Jaffe ES., Gascoyne RD., Campo E., Rosenwald A., Ott G., Delabie J., Rimsza L., Staudt LM. Cancer - Interactions investigated in the context of cancer cIAP2 was confirmed to be the protein produced from the BIRC3 gene by a blat of an shRNA sequence. lstaudt@mail.nih.gov Cancer cell 2016 Only protein-protein interactions imex curation imex curation malt1_human Mucosa-associated lymphoid tissue lymphoma translocation protein 1 MALT lymphoma-associated translocation Paracaspase MALT1 MLT protein protein human Homo sapiens Human MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAELAGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQRSVDGVSESKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQDSKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHRGLGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSNVTPADSCHCSRTPDAFISSFAHHASCHFSRSNVPVETTDEIPFSFSDRLRISEK nemo_human NF-kappa-B essential modulator IKBKG FIP3 NEMO NF-kappa-B essential modifier Inhibitor of nuclear factor kappa-B kinase subunit gamma IkB kinase-associated protein 1 FIP-3 protein protein human Homo sapiens Human MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE bcl10_human B-cell lymphoma/leukemia 10 BCL10 CIPER CLAP Cellular homolog of vCARMEN Mammalian CARD-containing adapter molecule E10 Cellular-E10 CARD-like apoptotic protein B-cell CLL/lymphoma 10 CED-3/ICH-1 prodomain homologous E10-like regulator CARD-containing molecule enhancing NF-kappa-B protein protein human Homo sapiens Human MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVGRTENTIFSSTTLPRPGDPGAPPLPPDLQLEEEGTCANSSEMFLPLRSRTVSRQ birc2_human Baculoviral IAP repeat-containing protein 2 Inhibitor of apoptosis protein 2 TNFR2-TRAF-signaling complex protein 2 IAP homolog B RING finger protein 48 BIRC2 API1 MIHB RNF48 RING-type E3 ubiquitin transferase BIRC2 Cellular inhibitor of apoptosis 1 protein protein human Homo sapiens Human MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLLSTSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTTGENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLFVDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS birc3_human Baculoviral IAP repeat-containing protein 3 Inhibitor of apoptosis protein 1 TNFR2-TRAF-signaling complex protein 1 IAP homolog C Apoptosis inhibitor 2 RING finger protein 49 BIRC3 API2 MIHC RNF49 RING-type E3 ubiquitin transferase BIRC3 Cellular inhibitor of apoptosis 2 protein protein human Homo sapiens Human MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWPLTFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQDTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESSIIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDLLNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHDVIKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVSDLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS shrpn_human Sharpin SHARPIN SIPL1 Shank-associated RH domain-interacting protein Shank-interacting protein-like 1 PSEC0216 protein protein human Homo sapiens Human MAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGATVEGQNGSKSNSPPALGPEACPVSLPSPPEASTLKGPPPEADLPRSPGNLTEREELAGSLARAIAGGDEKGAAQVAAVLAQHRVALSVQLQEACFPPGPIRLQVTLEDAASAASAASSAHVALQVHPHCTVAALQEQVFSELGFPPAVQRWVIGRCLCVPERSLASYGVRQDGDPAFLYLLSAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQPSWSCPSCTFINAPDRPGCEMCSTQRPCTWDPLAAAST tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS nf-kb consensus site probe ds dna double stranded deoxyribonucleic acid ds DNA ds dna chemical synthesis Chemical synthesis (Chemical synthesis) GGGACTTTCC p19838-pro_0000030311 Nuclear factor NF-kappa-B p50 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG 1 433 q00653-pro_0000030322 Nuclear factor NF-kappa-B p52 subunit NFKB2 LYT10 DNA-binding factor KBF2 H2TF1 Lymphocyte translocation chromosome 10 protein Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 Oncogene Lyt-10 protein protein human Homo sapiens Human MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGSGGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSRDSGEEAAEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLA 1 454 relb_human Transcription factor RelB RELB I-Rel protein protein human Homo sapiens Human MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRSTDELEIIDEYIKENGFGLDGGQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRLVSPAPGPGPQPHLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSRASWEGRADFSQADVHRQIAIVFKTPPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLGELNSSDPHGIESKRRKKKPAILDHFLPNHGSGPFLPPSALLPDPDFFSGTVSLPGLEPPGGPDLLDDGFAYDPTAPTLFTMLDLLPPAPPHASAVVCSGGAGAVVGETPGPEPLTLDSYQAPGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT rel_human Proto-oncogene c-Rel REL protein protein human Homo sapiens Human MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQV 24tr2rqr-1 1931876 N/A 1931880 unspecified role unspecified role prey prey N/A 1931881 unspecified role unspecified role bait bait physical association physical association false false false Supp 4B Birinapant: an IAP inhibitor and promoter of Apoptosis. A small molecule SMAC Mimetic; Second Mitochondria-derived Activator of Caspases;gene=DIABLO. The SMAC/DIABLO protein is an endogenous antagonist of XIAP, cIAP1, and cIAP2. malt1-bcl10-5 1931876 N/A 1931881 unspecified role unspecified role bait bait N/A 1931882 unspecified role unspecified role prey prey physical association physical association false false false 4A, Supp 4 SM-164 - a small molecule SMAC Mimetic AT-406 - a small molecule SMAC Mimetic Birinapant: an IAP inhibitor and promoter of Apoptosis. A small molecule SMAC Mimetic; Second Mitochondria-derived Activator of Caspases;gene=DIABLO. The SMAC/DIABLO protein is an endogenous antagonist of XIAP, cIAP1, and cIAP2. malt1-bcl10-6 1931876 N/A 1931883 unspecified role unspecified role prey prey N/A 1931884 unspecified role unspecified role prey prey N/A 1931885 unspecified role unspecified role bait bait association association false false false 5C, Supp 5C SM-164 -a small molecule SMAC Mimetic AT-406 -a small molecule SMAC Mimetic Birinapant: an IAP inhibitor and promoter of Apoptosis. A small molecule SMAC Mimetic; Second Mitochondria-derived Activator of Caspases;gene=DIABLO. The SMAC/DIABLO protein is an endogenous antagonist of XIAP, cIAP1, and cIAP2. ikbkg-bcl10-3 1931876 N/A 1931885 unspecified role unspecified role bait bait N/A 1931880 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5A, Supp 5A SM-164 - a small molecule SMAC Mimetic AT-406 - a small molecule SMAC Mimetic Birinapant: an IAP inhibitor and promoter of Apoptosis. A small molecule SMAC Mimetic; Second Mitochondria-derived Activator of Caspases;gene=DIABLO. The SMAC/DIABLO protein is an endogenous antagonist of XIAP, cIAP1, and cIAP2. sharpin-malt1-1 1931876 N/A 1931885 unspecified role unspecified role bait bait N/A 1931880 unspecified role unspecified role prey prey N/A 1931882 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O95999:p.[Lys31Arg;Lys63Arg] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Supp 5 B The SHARPIN-MALT1 association was equivalent in cells expressing either WT or 2KR BCL10 malt1-bcl10-4 1931877 N/A 1931882 unspecified role unspecified role prey prey N/A 1931884 unspecified role unspecified role prey prey N/A 1931880 unspecified role unspecified role bait bait association association false false false 3A ikbkg-bcl10-1 1931877 N/A 1931881 unspecified role unspecified role bait bait N/A 1931882 unspecified role unspecified role prey prey physical association physical association false false false 4A Birinapant: an IAP inhibitor and promoter of Apoptosis. A small molecule SMAC Mimetic; Second Mitochondria-derived Activator of Caspases;gene=DIABLO. The SMAC/DIABLO protein is an endogenous antagonist of XIAP, cIAP1, and cIAP2. sharpin-birc2-1 1931877 N/A 1931883 unspecified role unspecified role prey prey N/A 1931884 unspecified role unspecified role prey prey N/A 1931885 unspecified role unspecified role bait bait association association false false false 5C Birinapant: an IAP inhibitor and promoter of Apoptosis. A small molecule SMAC Mimetic; Second Mitochondria-derived Activator of Caspases;gene=DIABLO. The SMAC/DIABLO protein is an endogenous antagonist of XIAP, cIAP1, and cIAP2. ikbkg-malt1-2 1931877 N/A 1931880 unspecified role unspecified role prey prey N/A 1931881 unspecified role unspecified role bait bait physical association physical association false false false Supp 4B malt1-bcl10-7 1931877 N/A 1931882 unspecified role unspecified role prey prey N/A 1931884 unspecified role unspecified role prey prey N/A 1931880 unspecified role unspecified role bait bait association association false false false 3Ai nf_kb consensus site probe-rela-1 1931878 N/A 1931886 unspecified role unspecified role prey prey human-hbl-1 Human-HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype hbl-1 HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype N/A 1931887 unspecified role unspecified role bait bait physical association physical association false false false 6B-1 Birinapant: a SMAC Mimetic; an IAP inhibitor and promoter of Apoptosis. nf_kb consensus site probe-nfkb1-1 1931878 N/A 1931888 unspecified role unspecified role prey prey human-hbl-1 Human-HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype hbl-1 HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype N/A 1931887 unspecified role unspecified role bait bait physical association physical association false false false 6B-2 Birinapant: a SMAC Mimetic; an IAP inhibitor and promoter of Apoptosis. nf_kb consensus site probe-nfkb1-2 1931878 N/A 1931889 unspecified role unspecified role prey prey human-hbl-1 Human-HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype hbl-1 HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype N/A 1931887 unspecified role unspecified role bait bait physical association physical association false false false 6B-3 Birinapant: a SMAC Mimetic; an IAP inhibitor and promoter of Apoptosis. A NIK inhibitor nf_kb consensus site probe-nfkb2-1 1931878 N/A 1931890 unspecified role unspecified role prey prey human-hbl-1 Human-HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype hbl-1 HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype N/A 1931887 unspecified role unspecified role bait bait physical association physical association false false false 6B-4 Birinapant: a SMAC Mimetic; an IAP inhibitor and promoter of Apoptosis. A NIK inhibitor nf_kb consensus site probe-relb-1 1931878 N/A 1931891 unspecified role unspecified role prey prey human-hbl-1 Human-HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype hbl-1 HBL-1 diffuse large B cell lymphoma, activated B cell-like (ABC) subtype N/A 1931887 unspecified role unspecified role bait bait physical association physical association false false false 6B-5 ikbkg-bcl10-2 1931879 N/A 1931881 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9Y6K9:p.Leu329Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false N/A 1931882 unspecified role unspecified role prey prey physical association physical association false false false 4E