IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ halberg-2016-1 in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay tag visualisation tag visualisation Halberg N., Sengelaub CA., Navrazhina K., Molina H., Uryu K., Tavazoie SF. Cancer - Interactions investigated in the context of cancer Amino acid sequence of GST-FAPP-PH domain located from genomic location of stated primers. nils.halberg@uib.no,stavazoie@rockefeller.edu Cancer cell 2016 Only protein-protein interactions imex curation imex curation halberg-2016-4 human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Halberg N., Sengelaub CA., Navrazhina K., Molina H., Uryu K., Tavazoie SF. Cancer - Interactions investigated in the context of cancer Flag tag was determined to be C terminal by translating appropriate primer sequences. nils.halberg@uib.no,stavazoie@rockefeller.edu Cancer cell 2016 Only protein-protein interactions imex curation imex curation halberg-2016-2 in vitro In vitro liposome binding assay liposome binding assay weight by staining molecular weight estimation by staining weight by staining Halberg N., Sengelaub CA., Navrazhina K., Molina H., Uryu K., Tavazoie SF. Cancer - Interactions investigated in the context of cancer "Liposome Pull Down Assay":-Liposomes (phosphatidylcholine, phosphatidylethanolamine and phosphoinositides -ratio 65/24/4) were mixed with PITPNC1. After incubation and centrifugation levels of PITPNC1 in the supernatant and pellet were detected by SDS-PAGE followed by SimplyBlue staining. The liposome bound fraction was determined as PITPNC1 protein levels in the pellet compared to supernatant. nils.halberg@uib.no,stavazoie@rockefeller.edu Cancer cell 2016 Only protein-protein interactions imex curation imex curation halberg-2016-3 human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Halberg N., Sengelaub CA., Navrazhina K., Molina H., Uryu K., Tavazoie SF. Cancer - Interactions investigated in the context of cancer Flag tag was determined to be C terminal by translating appropriate primer sequences. nils.halberg@uib.no,stavazoie@rockefeller.edu Cancer cell 2016 Only protein-protein interactions imex curation imex curation halberg-2016-5 human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Halberg N., Sengelaub CA., Navrazhina K., Molina H., Uryu K., Tavazoie SF. Cancer - Interactions investigated in the context of cancer nils.halberg@uib.no,stavazoie@rockefeller.edu Cancer cell 2016 Only protein-protein interactions imex curation imex curation phosphatidylinositol-3-phosphate phosphatidylinositol 3-phosphate phosphatidylinositol 3-phosphates PI(3)P PtdIns3P small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) q9ukf7-1 Cytoplasmic phosphatidylinositol transfer protein 1 PITPNC1 Mammalian rdgB homolog beta Retinal degeneration B homolog beta sp1 protein protein human Homo sapiens Human MLLKEYRICMPLTVDEYKIGQLYMISKHSHEQSDRGEGVEVVQNEPFEDPHHGNGQFTEKRVYLNSKLPSWARAVVPKIFYVTEKAWNYYPYTITEYTCSFLPKFSIHIETKYEDNKGSNDTIFDNEAKDVEREVCFIDIACDEIPERYYKESEDPKHFKSEKTGRGQLREGWRDSHQPIMCSYKLVTVKFEVWGLQTRVEQFVHKVVRDILLIGHRQAFAWVDEWYDMTMDEVREFERATQEATNKKIGIFPPAISISSIPLLPSSVRSAPSSAPSTPLSTDAPEFLSVPKDRPRKKSAPETLTLPDPEKKATLNLPGMHSSDKPCRPKSE phosphatidylinositol 4-phosphates phosphatidylinositol 4-phosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) phosphatidylinositol 5-phosphate phosphatidylinositol 5-phosphate PI(5)P PtdIns5P small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 1-phosphatidyl-1d-myo-inositol 3,5-bisphosphate 1-phosphatidyl-1D-myo-inositol 3,5-bisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) pkha3_human Pleckstrin homology domain-containing family A member 3 PLEKHA3 FAPP1 Phosphatidylinositol-four-phosphate adapter protein 1 protein protein human Homo sapiens Human MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHHDENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLHHPDPLVSPVSPSPVQMMKRSVSHPGSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSESEDTLPSFSS 1433e_human 14-3-3 protein epsilon YWHAE protein protein human Homo sapiens Human MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ rab1b_human Ras-related protein Rab-1B RAB1B protein protein human Homo sapiens Human MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC 1433f_human 14-3-3 protein eta YWHAH YWHA1 Protein AS1 protein protein human Homo sapiens Human MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN 1433t_human 14-3-3 protein theta YWHAQ 14-3-3 protein tau 14-3-3 protein T-cell Protein HS1 protein protein human Homo sapiens Human MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN 1433g_human 14-3-3 protein gamma YWHAG Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN phosphatidylinositol_3_phosphate-pitpnc1-1 1931320 N/A 1931325 unspecified role unspecified role bait bait N/A 1931326 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2A-1,Supp fig 2 weaker interaction phosphatidylinositol 4_phosphates-pitpnc1-1 1931320 N/A 1931327 unspecified role unspecified role bait bait N/A 1931326 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2A-2, Supp fig 2 phosphatidylinositol_1-pitpnc1-1 1931320 N/A 1931328 unspecified role unspecified role bait bait N/A 1931326 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2A-3, Supp fig 2 weaker interaction phosphatidylinositol_1-pitpnc1-2 1931320 N/A 1931329 unspecified role unspecified role bait bait N/A 1931326 unspecified role unspecified role prey prey n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2A-4 weaker interaction phosphatidylinositol 4_phosphates-plekha3-1 1931320 N/A 1931327 unspecified role unspecified role bait bait N/A 1931330 unspecified role unspecified role prey prey ph_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Supp fig 2B pitpnc1-rab1b-2 1931321 N/A 1931331 unspecified role unspecified role prey prey N/A 1931332 unspecified role unspecified role prey prey N/A 1931326 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false 3B binding of RAB1b is weak pitpnc1-rab1b-3 1931321 N/A 1931332 unspecified role unspecified role prey prey N/A 1931326 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9UKF7-1:p.[Ser274Ala;Ser299Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3Bi phosphatidylinositol 4_phosphates-pitpnc1-2 1931322 N/A 1931327 unspecified role unspecified role bait bait N/A 1931326 unspecified role unspecified role prey prey Q9UKF7-1:p.Asn88Phe mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9UKF7-1:p.Thr58Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2 B/E pitpnc1-rab1b-1 1931323 N/A 1931333 unspecified role unspecified role prey prey N/A 1931334 unspecified role unspecified role prey prey N/A 1931331 unspecified role unspecified role prey prey N/A 1931335 unspecified role unspecified role prey prey N/A 1931336 unspecified role unspecified role prey prey N/A 1931337 unspecified role unspecified role prey prey N/A 1931332 unspecified role unspecified role prey prey N/A 1931326 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false 3A pitpnc1-rab1b-4 1931324 N/A 1931332 unspecified role unspecified role neutral component neutral component N/A 1931326 unspecified role unspecified role neutral component neutral component c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false 3F The vast majority of the overlap between the two proteins is detected in the perinuclear Golgi region.