IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tang-2016-2 yeast Saccharomyces cerevisiae Baker's yeast yeast display yeast display antibody detection identification by antibody antibody detection Tang H., Wang Y., Chlewicki LK., Zhang Y., Guo J., Liang W., Wang J., Wang X., Fu YX. Cancer - Interactions investigated in the context of cancer Binding was analyzed by flow cytometry Yang-Xin.Fu@UTSouthwestern.edu Cancer cell 2016 Only protein-protein interactions imex curation imex curation tang-2016-1 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Tang H., Wang Y., Chlewicki LK., Zhang Y., Guo J., Liang W., Wang J., Wang X., Fu YX. Cancer - Interactions investigated in the context of cancer The Supplementary Methods section states that "human or mouse LT-beta-R-Ig or HVEM-Ig" were used for ELISA; the "Ig" has been confirmed to be the Fc receptor by the authors. Yang-Xin.Fu@UTSouthwestern.edu Cancer cell 2016 Only protein-protein interactions imex curation imex curation tnf14_human Tumor necrosis factor ligand superfamily member 14 Herpes virus entry mediator ligand UNQ391/PRO726 TNFSF14 HVEML LIGHT protein protein human Homo sapiens Human MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV tnr3_human Tumor necrosis factor receptor superfamily member 3 LTBR D12S370 TNFCR TNFR3 TNFRSF3 Lymphotoxin-beta receptor Tumor necrosis factor C receptor Tumor necrosis factor receptor 2-related protein Tumor necrosis factor receptor type III protein protein human Homo sapiens Human MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLLATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD tnr14_human Tumor necrosis factor receptor superfamily member 14 TNFRSF14 HVEA HVEM UNQ329/PRO509 Herpes virus entry mediator A Tumor necrosis factor receptor-like 2 protein protein human Homo sapiens Human MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH tnf14_mouse Tumor necrosis factor ligand superfamily member 14 Tnfsf14 Light protein protein mouse Mus musculus Mouse MESVVQPSVFVVDGQTDIPFRRLEQNHRRRRCGTVQVSLALVLLLGAGLATQGWFLLRLHQRLGDIVAHLPDGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV tnr3_mouse Tumor necrosis factor receptor superfamily member 3 Lymphotoxin-beta receptor Ltbr Tnfcr Tnfrsf3 protein protein mouse Mus musculus Mouse MRLPRASSPCGLAWGPLLLGLSGLLVASQPQLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPEPGAMLLLAILLSLVLFLLFTTVLACAWMRHPSLCRKLGTLLKRHPEGEESPPCPAPRADPHFPDLAEPLLPMSGDLSPSPAGPPTAPSLEEVVLQQQSPLVQARELEAEPGEHGQVAHGANGIHVTGGSVTVTGNIYIYNGPVLGGTRGPGDPPAPPEPPYPTPEEGAPGPSELSTPYQEDGKAWHLAETETLGCQDL q71f55_mouse Tnfrsf14 Hvem protein protein mouse Mus musculus Mouse MEPLPGWGSAPWSQAPTDNTFRLVPCVFLLNLLQRISAQPSCRQEEFLVGDECCPMCNPGYHVKQVCSEHTGTVCAPCPPQTYTAHANGLSKCLPCGVCDPDMGLLTWQECSSWKDTVCRCIPGYFCENQDGSHCSTCLQHTTCPPGQRVEKRGTHDQDTVCADCLTGTFSLGGTQEECLPWTNCSAFQQEVRRGTNSTDTTCSSQVVYYVVSILLPLVIVGVGIAGFLICTRRHLHTSSVAKELEPFQQEQQENTIRFPVTEVGFAETEEETASN tnfsf14-ltbr-1 1931816 N/A 1931818 unspecified role unspecified role bait bait O43557:p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 1931819 unspecified role unspecified role prey prey physical association physical association false false false 2 A tnfsf14-ltbr-2 1931816 N/A 1931818 unspecified role unspecified role bait bait N/A 1931819 unspecified role unspecified role prey prey physical association physical association false false false 2 A tnfsf14-ltbr-3 1931816 N/A 1931818 unspecified role unspecified role bait bait N/A 1931820 unspecified role unspecified role prey prey physical association physical association false false false 2 Ai tnfsf14-ltbr-4 1931816 N/A 1931820 unspecified role unspecified role prey prey N/A 1931818 unspecified role unspecified role bait bait O43557:p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2 A tnfsf14-ltbr-5 1931816 N/A 1931821 unspecified role unspecified role bait bait N/A 1931822 unspecified role unspecified role prey prey physical association physical association false false false 2 Am tnfsf14-tnfrsf14-1 1931816 N/A 1931821 unspecified role unspecified role bait bait N/A 1931823 unspecified role unspecified role prey prey physical association physical association false false false 2 Am tnfsf14-tnfrsf14-2 1931816 N/A 1931823 unspecified role unspecified role prey prey N/A 1931818 unspecified role unspecified role bait bait O43557:p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys] mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2 Am tnfsf14-ltbr-6 1931816 N/A 1931822 unspecified role unspecified role prey prey N/A 1931818 unspecified role unspecified role bait bait O43557:p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys] mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2 A/B tnfrsf14-tnfsf14-1 1931817 N/A 1931820 unspecified role unspecified role bait bait probable_Fc_tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1931818 unspecified role unspecified role prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false O43557:p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false 3A-1 tnfrsf14-tnfsf14-2 1931817 N/A 1931823 unspecified role unspecified role bait bait probable_Fc_tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1931818 unspecified role unspecified role prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false O43557:p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false 3A-2 tnfrsf14-tnfsf14-3 1931817 N/A 1931818 unspecified role unspecified role prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false O43557:p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 1931819 unspecified role unspecified role bait bait probable_Fc_tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3A-3 ltbr-tnfsf14-1 1931817 N/A 1931822 unspecified role unspecified role bait bait probable_Fc_tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1931818 unspecified role unspecified role prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false O43557:p.[Ala138Thr;Ser160Gly;Asp221_Glu222delinsGlyLys] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false 3A-4